KEGG   Brugia malayi (filaria): Bm1_17330Help
Entry
Bm1_17330         CDS       T01050                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
bmy  Brugia malayi (filaria)
Pathway
bmy00020  Citrate cycle (TCA cycle)
bmy00190  Oxidative phosphorylation
bmy01100  Metabolic pathways
bmy01200  Carbon metabolism
Module
bmy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bmy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bmy_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:bmy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bm1_17330
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Bm1_17330
Enzymes [BR:bmy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Bm1_17330
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 DAO HI0933_like GIDA FAD_binding_3 FAD_oxidored Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 6098375
NCBI-ProteinID: XP_001894923
UniProt: A0A0J9XWZ6
LinkDB All DBs
AA seq 646 aa AA seqDB search
MLSAARCLVTKTCQQRKLSLSAVCKGTRTSNIAEYCVVDHAYDAVVVGAGGAGLRAAMGL
SEGGQKVAVVTKLFPTRSHTVAAQGGVNAALGNMNPDDWRWHFYDTVKGSDWLGDQNAIH
YMTREAVRAVIEMENYGMPFSRTEEGKIYQRSFGGQSNNFGKGGMARRTCCVADRTGHSM
LHTLYGSSLQYNCRYFIEYFALDLLMDNGRCVGIIAMDLEDGSIHRFRAKNTVVATGGYG
RAFFSCTSAHTCTGDGTAMITRAGLQNSDMEFVQFHPTGIYGAGCLITEGSRGEGGYLVN
SEGERFMKKYAPNALDLASRDVVSRAMTIEIMEGRGVGKDKDHIYLQLHHLPAKDLHAKL
PGIMETAMIFAGVDAAKEPIPVIPTVHYNMGGIPTNYMGQVLTYKRDKGDQLVPGLYACG
EAAAHSVHGANRLGANSLLDLVVFGRACAIDILEKAKKSCEKIPELPKDAGESTITNVDK
LRFAKGDIPTAALRLKMQKTMQQHAAVFRRGDILKEGIKKMETLFKEQKLLKTTDRGLVW
NSDLAETFELQNLMLNATQTIIAAEARKESRGAHARDDFPTRIDELDYSRPLDGQTKKSL
DQHWRKHTIIEQDHETGKITLHYRPVIDQTLDKNETDWVQPMIRSY
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgctaagtgcggcccgttgtttggtgacgaaaacatgtcaacaaagaaaactttcgtta
tcagctgtgtgtaaaggaacgaggacatctaatatcgctgaatattgtgttgtggatcat
gcatacgatgcggttgttgttggagctggtggagctggtttacgagctgctatgggtctc
agcgaaggtggtcagaaggttgcggtagttacaaagttatttccaacacggtctcatacg
gttgctgctcagggaggtgttaatgcagctttaggtaatatgaatccggatgattggcga
tggcatttctacgatactgttaaaggaagtgattggctaggagatcagaatgctatacat
tacatgactcgtgaagcggttcgtgctgttattgaaatggaaaattatggtatgcctttt
tcacgaacagaagagggtaagatatatcagcgttcattcggtggacaaagtaacaatttt
ggtaaaggtggcatggctcgtcggacgtgctgcgtagcagatcgtacaggacattcaatg
ttgcatacgttatatggttcgtcacttcagtataactgtcgatatttcatcgaatatttc
gcacttgatcttttgatggataacggacgatgtgttggaattattgctatggaccttgag
gatggaagcatacaccgattccgtgcgaagaacacggtggtcgcaacaggaggatatgga
cgagctttctttagttgtacttctgcacatacgtgcactggtgatggcacagcaatgatt
actcgagctggactgcagaattctgatatggaatttgttcagtttcatccaaccggtatt
tatggtgccggttgtctcatcactgagggttctcgaggtgaaggtggctacttggtgaac
agtgaaggtgaacgcttcatgaagaagtatgcaccgaatgcgttagatctggcctcacga
gatgttgtttcgcgagcgatgacgatcgaaatcatggaaggtcgtggtgtcgggaaggat
aaggatcatatttatttgcagttgcatcacttacctgcgaaagatttgcatgccaaattg
ccaggtattatggaaactgcgatgatttttgctggtgtagatgctgcgaaagaaccaata
cccgttataccaacagtccattataatatgggaggcataccaacgaattatatgggacag
gttctaacttacaaacgcgataaaggtgaccagttggtgccaggattatatgcttgcggt
gaagcagcagcacattcagtgcatggtgcaaatcgtctgggagctaattcgttgctcgat
cttgtcgtttttggacgtgcttgtgccatagatattctagaaaaagccaagaaatcatgc
gagaagattcctgaattgccgaaagatgcgggtgaatcaaccattacaaacgtcgacaag
ctgcgttttgccaaaggtgatattcctactgctgccttaagattgaagatgcagaaaacg
atgcaacagcatgcagctgtgttccgacgcggtgacattttgaaggaaggtattaaaaaa
atggagactcttttcaaggagcaaaaacttcttaaaacaacagatcgtggattagtgtgg
aattcggatcttgctgagacatttgaactgcagaatttaatgctaaatgccactcaaaca
atcattgctgcagaagctagaaaagaaagtcgtggagcacatgctcgagacgatttcccg
acacggatagatgagcttgattattcgagaccacttgatggtcaaactaagaagtcactc
gatcaacactggcgtaagcatactatcatcgaacaggatcacgagactgggaagattacc
ttacattatcgaccagtaatcgaccagacattagataagaacgagacagactgggttcaa
ccgatgattcgatcttattga

DBGET integrated database retrieval system