KEGG   Brugia malayi (filaria): Bm1_23610Help
Entry
Bm1_23610         CDS       T01050                                 

Definition
(RefSeq) arginine kinase
  KO
K00933  creatine kinase [EC:2.7.3.2]
Organism
bmy  Brugia malayi (filaria)
Pathway
bmy00330  Arginine and proline metabolism
bmy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Bm1_23610
Enzymes [BR:bmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.2  creatine kinase
     Bm1_23610
Exosome [BR:bmy04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   Bm1_23610
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-gua_Ptrans ATP-gua_PtransN
Motif
Other DBs
NCBI-GeneID: 6099624
NCBI-ProteinID: XP_001896180
LinkDB All DBs
AA seq 251 aa AA seqDB search
MADPNVIAKIEESFHKLQEAKDCHSLLKKHLSKAIIDELKNKKTKLGATLLDVIQSGVAN
LDSGVGVYAPDADSYTLFKPLFDPIIEEYHNGFGSNQKQPEIDLGEDKISLLTDLDPEGK
YINSTRVRCGRSLQGYPFNPCLTEENYKEMEDKIRKVLCGFSDPELKGTYYPLTGMTKDV
QKQLIDDHFLFKEGDRFLQAANACRYWPVGRGIFHNENKTFLIWINEEDHLRIISMQKGG
NVGQVSNTSDN
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggcagatccgaatgttattgctaaaatcgaagaaagtttccataaattacaggaagca
aaagattgtcactctttgctcaagaagcatttatcaaaagcaatcattgatgagctaaaa
aataaaaagacaaaacttggtgcaacacttttagatgttatacaatccggtgtagcaaat
cttgattctggtgttggcgtatatgcaccagatgctgattcttatactctattcaagcca
ttattcgatccgatcattgaagaatatcataatggcttcggatcaaatcaaaaacaaccg
gaaatcgaccttggtgaagacaaaataagtttgctcactgatttggatccggaaggaaaa
tatatcaattcaaccagagtacgatgtggacgttcgcttcaaggctatccttttaatcct
tgccttacggaagaaaattacaaagaaatggaagacaaaatcagaaaagttctgtgcgga
ttctctgatccggaactgaaaggaacatattatccattgactggaatgacaaaagatgtt
cagaaacaacttattgatgatcatttcttattcaaagaaggtgacagatttctgcaagcc
gcaaatgcatgccgatactggccagttggaagaggtattttccacaatgaaaataaaact
ttcctcatatggatcaatgaggaggatcatctacgcataatatccatgcaaaagggtggt
aatgttggacaagtgagtaatacttctgataactaa

DBGET integrated database retrieval system