KEGG   Brugia malayi (filaria): Bm1_30085
Entry
Bm1_30085         CDS       T01050                                 

Definition
(RefSeq) Apoptosis regulator proteins, Bcl-2 family protein
  KO
K20094  cell death protein 9
Organism
bmy  Brugia malayi (filaria)
Pathway
bmy04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:bmy00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    Bm1_30085
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bmy02000]
    Bm1_30085
Transporters [BR:bmy02000]
 Other transporters
  Pores ion channels [TC:1]
   Bm1_30085
SSDB
Motif
Pfam: Bcl-2 STE3 BH4
Other DBs
NCBI-GeneID: 6100909
NCBI-ProteinID: XP_001897456
LinkDB
AA seq 476 aa
MLLSDSIISKHDKCNECSNKRLGCEDGMYLIQDFVADYIQYRIRIHGNRKVQNLFYPCRQ
ECENGLIRSVALIFEEKHKEELQKMVEMLCENESFSCSRYIEIMEQFVCIHNESPSQMSY
GRLIALIAFAGLIATRLIDMKYFAEVSMVMSYTSKFLHKRIALTWPYHKRSWSKFFDLAR
TIIKLNKTEEVESKIEKNEWRSAVSGLAVFGVRYVSRYFEQRRDTFCVHVVFINKRVKSF
IFEEMSAVDLVTVGNDQYNEDTVDESMDLRGLSTIQSYVTDYIQYRVHLHNVYCPRLPEI
PVSDDYRFELIRAVALIFEKKHAEELTNMVTTLCLNGRLTFQRYVEVVECFAHNDDDESN
KQLSYGRLVALIAFAGLVAMKLCDLQLFTEVSMIAPYTSKFLHKRIVLTWPQDRRSWEDF
FDRARTIIDKNEAEESEKVNLKSECNRWWLSIRALVIFGMFGIGAFTLVKTILKTR
NT seq 1431 nt   +upstreamnt  +downstreamnt
atgctccttagtgattcaatcatttcaaaacacgacaaatgtaacgaatgtagcaataaa
cggttaggatgtgaagatgggatgtaccttatacaagatttcgttgctgattatattcaa
tatcggattcgcatacatggaaatcgtaaagtacaaaatctgttttacccttgtaggcaa
gaatgcgaaaatggtttgattcgttctgtggctttaattttcgaagagaagcataaagaa
gagcttcaaaaaatggtggaaatgttatgcgaaaatgagagcttttcgtgcagtcgatat
atcgagattatggagcaatttgtgtgcattcacaacgaatcaccatcacaaatgtcttat
ggacgtttgatagcactgatcgcattcgctggactgattgctacacgattgatcgacatg
aaatatttcgcagaagtttcaatggttatgtcatacacctcaaaatttctgcacaaaaga
attgctttgacgtggccatatcataaacgttcttggagtaaattttttgatcttgcaagg
acgataatcaagctgaacaaaactgaagaagtagagtcaaaaatagaaaagaatgaatgg
cggtcagcagttagyggattggctgttttcggtgttcgatacgtttcgcgatacttcgag
caacggagagacacgttttgcgttcacgtagtgttcatcaacaaaagagtgaaaagtttt
atttttgaagaaatgagtgccgttgatttagtcacagtgggaaatgatcaatataatgaa
gatacagtcgatgaatcaatggatctgagagggcttagtaccatacagagttacgtcact
gattatatccagtatcgtgtacatctacataacgtttactgtccgcgtttaccagaaatc
ccagtttcggacgattatcgatttgaattaattcgagcggttgccttaatttttgaaaag
aagcatgcagaagaactcacgaatatggttacaacattatgccttaatggaaggcttaca
tttcaacgatatgttgaggtcgtagaatgttttgctcataacgatgatgatgagtcaaat
aagcaactgtcttatggaagattggtggcattgattgcatttgctggattagttgcgatg
aaactttgtgatttacagttgtttacagaagtgtcaatgattgcaccatatacgtctaaa
ttcttgcacaagcgaatcgttttgacatggccacaggatagacgttcttgggaagacttt
tttgatcgcgccagaaccataattgataagaatgaagctgaagagagtgaaaaagttaac
ttgaaatctgaatgcaatcgatggtggctgtcgattagagcattggtgatattcggcatg
tttggtatcggtgccttcacattggtgaaaacaatactaaaaacacgataa

DBGET integrated database retrieval system