KEGG   Brugia malayi (filaria): Bm1_30590Help
Entry
Bm1_30590         CDS       T01050                                 

Definition
(RefSeq) Tyrosine-protein kinase abl-1
  KO
K06619  abelson tyrosine-protein kinase 1 [EC:2.7.10.2]
Organism
bmy  Brugia malayi (filaria)
Pathway
bmy04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:bmy00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    Bm1_30590
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bmy01001]
    Bm1_30590
Enzymes [BR:bmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     Bm1_30590
Protein kinases [BR:bmy01001]
 Non-receptor tyrosine kinases
  ABL family
   Bm1_30590
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 SH3_1 SH3_9 SH3_2 Haspin_kinase Kdo SH3_3 Kinase-like
Motif
Other DBs
NCBI-GeneID: 6101010
NCBI-ProteinID: XP_001897557
LinkDB All DBs
AA seq 722 aa AA seqDB search
MDHRPSSVDTFLTHHHHHQHHHHHRLHQQDSSRWSSREDLLNGSATSNENDSLFVALYDF
HGVGEEQLSLKRGDHVRVIGHNKAGEWCEAQLVNTRRENSRRTGCIGWVPSSYIAPSNSL
EKHSWYHGKVSRSESEYLLSSGISGSFLVRESETSIGQFSISVRHDGRVYHYRISVDRNK
WLYITQESKFKTLGELVHHHSLHADGLICTLLYPASKKERPPMVFSLSPTQPDEWEVERS
EIIMRSGGQYGDVYEGYWKKHEKVVAVKTLKEEAMALHDFLAEAAIMKDLHHPNLVQLMG
VCTREPPFYIITEYMNRGNLLDYLRKCDKKLSPTVLMYMATQIASGMAYLESRNFIHRDL
AARNCLVAEENVVKVADFGLARFMREDTYTAHAGAKFPIKWTAPEGLAYNTFSTKSDVWA
FGVLLWEIATYGMSPYPGVELNSVYGLLEKGFRMDAPEGCPPSVYRLMLQCWNWSPSDRP
RFKEIHASLESLFPQSNIDEEVDKQLERSRTSSRRHSLSSHRIAMGNDCINIPSSVVPVA
SPRISGIQGGGCAGNNTGTVVVVPSTSSSLAGTSLPPPPTIEFPPPPPWNQDSCVGGASS
NSSTATQCSSARDIWDAAKIKTGQRNLPLPIPPSSAKPKLQKLDNLPTCDVLVSPLAEKN
LRKAVSKFGTMPKNARIDAYLESMSLQEDGDQSPNASGECSGGLSDDSLDAIPDSYNNCW
NR
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atggatcatcgaccgtcttctgttgatacgttcttgacacaccaccaccaccaccagcac
catcatcatcatcgtcttcatcagcaggattcgtcaagatggtcatccagagaagatttg
ttgaacggatcagcaacaagcaacgaaaatgattccttattcgttgcgttgtacgatttc
cacggtgttggcgaagagcagctttcgctgaagagaggtgatcatgtgcgggtgattgga
cataataaagctggcgaatggtgtgaggcacaattggtgaatacccgacgtgagaattcg
agacgtactggttgcattggttgggtaccatcatcctatattgcaccttctaattcactg
gaaaaacattcatggtatcatggaaaagtaagccgaagcgagagcgagtacctattaagt
tccggtattagcggtagctttttggtgcgtgaatcggaaaccagcattggacaattttca
atttcagtacggcatgatggccgcgtttatcattatcggatttcagtggatcgtaacaaa
tggttatacataacacaagaaagcaaattcaaaacactgggcgaattggttcatcatcat
agtcttcatgcggacggccttatctgtacgttactctacccagcatccaaaaaggaacga
ccaccgatggtattttcattatcgccaactcaacctgatgaatgggaagtggagaggtca
gaaattatcatgagaagcggtggacaatacggcgatgtttatgagggctactggaaaaaa
catgaaaaagtggttgctgtgaaaactttgaaagaagaggctatggcgctacacgacttt
ttggcagaagcagcaattatgaaggacttacatcatccgaatttggtacagttaatggga
gtatgtactcgtgaaccgccattttatattatcaccgaatatatgaatagaggaaatttg
ctcgactatctcaggaaatgtgataagaaattatcaccaacagtgctgatgtacatggct
acacagattgcatctggaatggcttatcttgaatcacgtaatttcatccatcgggatttg
gctgcacgaaactgtttggtagccgaagagaatgttgtcaaagttgctgattttggtctt
gcacgatttatgagggaagatacttatactgctcatgctggagcaaagtttccgatcaaa
tggactgcaccagaaggtcttgcctataacactttcagtactaaaagtgatgtctgggca
tttggtgtactattatgggaaatcgctacttatgggatgagtccatatccaggtgttgag
ttgaatagtgtttacggattacttgaaaaaggttttcgaatggatgctccggaaggttgt
cctccatcagtttaccggttgatgttgcaatgctggaattggtcacctagtgatcgacca
cgtttcaaagaaatccatgccagcttggagtcactttttcctcaatccaatattgatgaa
gaggttgacaagcagttagaacgttcacgcacatcatcacggcgtcacagtttgtcatct
catcgcattgcgatgggcaatgattgcatcaatattccgtcaagcgttgtaccagttgca
tctccgcgtatctccggtattcagggcggcggttgtgctggaaataatactggcacggtt
gttgtagttccatcaactagctcttcgttagctggcacgtcgctaccaccaccacctact
atcgaattcccaccaccaccaccatggaaccaggatagttgcgtcggtggcgcgtcatca
aattcttctacagccacccaatgcagtagtgcacgtgacatttgggatgcggctaaaata
aaaactggccagcgtaatctaccgttaccgattccaccatcatctgcaaagccaaagttg
caaaaactagataatctaccaacttgtgacgtgttggtttcgccgctagcggagaaaaat
ttgcgcaaggcggttagcaaatttggtaccatgccgaaaaatgctcgaattgatgcatac
ctggaatcgatgtcattgcaagaagatggtgaccagtcgccgaatgccagtggtgaatgc
agtggtggtctgtcagatgattcgttggatgctattccagattcctacaataattgctgg
aataggtaa

DBGET integrated database retrieval system