KEGG   Brugia malayi (filaria): Bm1_31085Help
Entry
Bm1_31085         CDS       T01050                                 

Definition
(RefSeq) Angiotensin-converting enzyme family protein
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
bmy  Brugia malayi (filaria)
Brite
KEGG Orthology (KO) [BR:bmy00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bmy01002]
    Bm1_31085
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bmy04147]
    Bm1_31085
   04090 CD Molecules [BR:bmy04090]
    Bm1_31085
Enzymes [BR:bmy01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     Bm1_31085
Peptidases [BR:bmy01002]
 Metallo Peptidases
  Family M2
   Bm1_31085
Exosome [BR:bmy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bm1_31085
CD molecules [BR:bmy04090]
 Proteins
  Bm1_31085
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 EB
Motif
Other DBs
NCBI-GeneID: 6101109
NCBI-ProteinID: XP_001897661
LinkDB All DBs
AA seq 1017 aa AA seqDB search
MTRRTLLIQQLIISVLLFGLYAQHGENSSGQNESRKETGMSTLENAFTSSKNSVIWPPTL
IQSTVNDALIIAEAETKNVFRTYSIAKQPDSLDMVPSQSHSTEFPHQSNSTPEPKVMLSS
SFHPSTYKPELHHQSMLTTTAKITRPFTDNSSHLAMQSAQSSQLTVHAEDSQPVTEPSDM
KLSNAFEDDAERFDEDDSNNADSSKPSAIDNEAIEELVNRFLNSDAAEDGKDEKLNKEAL
KLINSSKYWDVSNLEPEGSIRDSKKAQEWMNGYAVEAQKVLREVALAGWNYVTSVSHLTK
QLLDEAEETLGKFVKSSSKQAKQFDIAAIEDKSLKRQFELLLVEGINALDENDFNEYNEL
QKLIAKAYAETSVCETDNATICPYRVPDIVSIIAHENDGPKAFRLWIALRDALGPKLVTS
YKRLIELINKGAKLNGFSDGGAMWRSPYELLVSRQEKAEQSDTVVLLQKLYQQINPFYKQ
LHAYIRRQIPALYGLTNVSSLTRDGPIPAHLLKSIAGDNWIAFYRDTKPFQDEDDLAREV
QDNFQKRNYTVKNMFKQTYKTLKQIGFDKLPSSFWTKSIFTRTWSRDMLCYPPAAYDMRN
ELDYRVKACAHLNLPDFELTHKLLVHIYYYYMCREQPLLFREATNPSFLTAVTNAFAINA
RNIEYLKMMKLITSETGFSRSKIINRLYMEALEDFVKLPFDFAVDMWRFHIFDGTSTNVT
WNSDWWRLSELFQGIKSPVDRKSTDFDAIAFSTIAQTHAPAMKHFFAYIMQFQILKALCP
NATNLSNGCMLERSPAIDKIKKVMALGSSITWREALEIIIGSKEVDASAMLEYYQPLISW
LEEANAKEHVYIGWDGFGKPFTESEVPKLRENTASMDTFSEILSETQFAFPGGDCSNSRE
CLLDSVCRNNICECKEGLYTLRIGNTYNCVPGNPADAGFGDGHGGLVIGLHSADDSSVVP
IPEPEEHNKQLGAKPGSEHRNGRPGSLPEAELEHKGTSISIPTLILVLLFTVLIVLL
NT seq 3054 nt NT seq  +upstreamnt  +downstreamnt
atgacaagaaggacgttgttgatacagcagctgataatatcagtgcttctgtttggcctc
tacgctcaacatggggaaaactcatctggacaaaatgagtccagaaaagaaactggtatg
tcgacattagaaaacgctttcacatcatccaaaaattctgtaatctggcctcctacattg
atacaaagtacagtgaacgatgcactaataatagcagaagcagaaacaaaaaacgttttc
cgaacttattccattgctaagcaaccagattcattggatatggtaccgtcgcagagtcat
tctacagaatttccccatcaatcaaattcaacacctgaaccaaaagtcatgttatcgtca
agttttcatccgagtacctataagccagaattgcaccatcaatctatgctgactaccact
gcaaaaattactaggccgtttactgacaattcttcacacttggccatgcaatcagcccaa
agttcacaacttacagttcatgctgaggattcccaaccagttacagaaccgagtgacatg
aaattaagcaatgccttcgaggatgatgctgagcggtttgacgaagatgatagtaataac
gcagactcttcgaaaccaagtgccattgataatgaagctatagaggaacttgttaatcgc
ttcctaaatagtgatgctgccgaagatggtaaagatgaaaagctgaataaagaagcttta
aaactgatcaattcaagcaaatactgggatgtgagcaatttagagcctgaaggctctata
cgagatagtaagaaagctcaggaatggatgaatggatatgctgttgaggcacaaaaagtt
ttacgcgaagtagctttagcaggatggaattatgttacatcagtatcacatcttactaaa
caacttcttgatgaagccgaagagacgctaggaaaatttgtgaaaagcagctcgaaacaa
gcgaagcagtttgatattgcagcaattgaggataaatcattgaaacgacaatttgagttg
cttttagtagaaggcattaatgctttggatgaaaatgacttcaatgaatacaatgaactt
caaaaattgatagcaaaagcatatgctgaaacttcagtttgtgaaacagacaacgcaacg
atatgtccatacagagtgcccgatattgtgtcaattatcgcccatgagaatgatggccct
aaagcatttcgtctttggatcgcgttgcgtgacgcattaggaccgaaactggttacttct
tacaaacgtctcattgagttgatcaataaaggagctaaattaaatggtttttcggatggc
ggagcgatgtggcgtagcccttacgaactgctcgtatcacgtcaagaaaaagcagaacaa
agtgacaccgttgttcttttgcaaaagttatatcaacaaatcaatccattttataaacag
ttacacgcatatataagacgtcaaatacctgctttgtacggcttaacaaacgtgtctagt
ctaacgcgagatggtcctatcccagcccatttgcttaagagtattgctggtgacaattgg
attgccttctatcgagatacaaagccattccaagacgaggatgatcttgcaagggaagtc
caagataactttcaaaaacgaaattatactgtgaaaaacatgtttaaacagacatataaa
accctcaaacaaattgggtttgacaaattgccatcaagtttttggacgaaatcaattttt
acgagaacctggagtagagatatgctttgttatccacctgctgcctacgatatgaggaat
gaacttgattatagggtgaaagcatgtgcgcatcttaatttgcccgattttgaattaacc
cataaattacttgtacacatatactattattacatgtgtcgtgagcagccacttttgttt
cgagaagcaacaaatccaagttttctgaccgctgtgactaatgctttcgcaattaatgct
cgaaatatagagtatttgaaaatgatgaaactaataacatctgagactggctttagccgc
tcaaaaattataaatcgtttgtatatggaagcacttgaagatttcgtcaaattacccttt
gacttcgcggttgatatgtggcgatttcatatatttgatggtacgtcgacaaatgttaca
tggaactccgattggtggcggctaagtgaattattccaagggatcaaatcgcctgtggat
cgaaaatcaactgatttcgatgctatcgctttttctaccattgctcaaacgcatgctcct
gcgatgaaacactttttcgcctacataatgcagtttcaaatcctaaaagctctgtgtcct
aacgcaacaaatttgagtaacggatgtatgttagaacgtagcccagctattgataaaatt
aagaaagttatggcgcttggttcttcaattacctggcgagaagcactggaaattatcata
ggtagtaaagaagttgatgcaagtgctatgttggaatattaccaacctctgataagttgg
cttgaagaagcaaacgctaaggaacacgtgtatattggatgggatggatttggaaagcca
tttacggaatcggaagtaccaaaacttcgagaaaataccgccagtatggatacattctca
gaaatattgagtgaaactcaatttgcatttccgggtggtgactgttcaaacagtagggaa
tgcttgttggattcggtctgtcgaaataatatttgtgaatgcaaagaaggactatatact
ctgaggattggcaatacttataactgtgttcccggaaatcctgctgatgcaggttttgga
gatggacatggtggcttagtcatcggtttacattcagcagacgacagcagtgtagtacct
attccagagcctgaggagcataataagcagttgggagcaaaaccgggatcggaacataga
aatggcaggccaggttcattaccggaagctgaactagaacataaaggaacttctatcagt
ataccgacattaatcttggtgttattatttactgtcctgatcgtactattatag

DBGET integrated database retrieval system