KEGG   Brugia malayi (filaria): Bm1_31310
Entry
Bm1_31310         CDS       T01050                                 

Definition
(RefSeq) Ras association domain family 1 isoform A
  KO
K09850  Ras association domain-containing protein 1
Organism
bmy  Brugia malayi (filaria)
Pathway
bmy04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:bmy00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04392 Hippo signaling pathway - multiple species
    Bm1_31310
SSDB
Motif
Pfam: Nore1-SARAH C1_1 RA PhoQ_Sensor
Other DBs
NCBI-GeneID: 6101154
NCBI-ProteinID: XP_001897707
LinkDB
AA seq 413 aa
MSKTLDYGGNSNNESDGKHVRSCQSATQQPRWFSGLRARISQLNMPEWLSQLGVKNFNYV
APTEEVLPGNKAEKKTDYKNDQPVRILDDVSEKLQICIHPEIDVNGSDTIGSWLWEEADY
GDTLALQHFGPLKNLITGCSHPGKGHDFLSLSVTHPTWCDKCGDFMWGFLTRAVKCGNCN
YTCHSKCKSLVTLDCKTADSTLSSCQELAVTSCSNLKMFTENDNILEEQKDETSGFVQIH
MNFMRPINVVAGDSLSFLDVTNESGEFFSMTEMIITLLRKFRVADNPRKFALYERVSQSL
ENPTIQNYSLTRISDDSFPLKIVRSWEEKGEKRQLVLQENDTGDILWDMFEVPELENFLK
ILEDEEKQYCFRIRQKYDAYRWFLDENLRNRGFTVDGDEFSSVKANSCISTDV
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgagtaagaccttggattatggtgggaatagtaacaacgaaagtgatgggaagcatgta
cgatcatgtcaatctgctactcaacaaccgaggtggttttctggattacgtgcaaggatc
tcgcagcttaatatgccagagtggctgagccaactcggagttaagaattttaattacgta
gcgccgacagaggaagtgttacctggtaacaaagcagaaaaaaaaacggactacaaaaat
gatcaaccagtgcggatattggatgatgtttcagagaagctacagatttgcattcatcca
gaaatagatgtaaatggaagtgatacgataggttcgtggttatgggaagaagctgattat
ggtgatactctcgctttgcagcactttggaccattgaagaatctcattacgggttgtagt
catccaggaaaaggacacgacttcttatcactgtctgttactcatccaacctggtgtgat
aaatgtggagattttatgtggggatttttgacacgagcggtaaaatgtggtaactgtaat
tacacttgtcactcaaaatgtaaatcgctggtaacactagattgtaaaacagctgacagt
acgttgagttcatgtcaggaattagctgtgacttcttgttcaaatctgaaaatgttcact
gaaaatgacaatattcttgaggaacaaaaagatgaaacgagcggttttgtacaaattcat
atgaattttatgcgacctattaatgtggtcgcaggcgattcactttcatttctggatgtc
acaaacgaatcgggtgagttcttcagtatgacagaaatgattataactttgctgcggaaa
tttcgagttgcggataatccgcggaagtttgcactgtatgagcgtgtttctcagtcatta
gaaaatccaactatacaaaattacagtttgacacgtatttcggacgactcatttccactc
aaaattgtgcgctcatgggaagagaaaggagagaaacgacaattagttttacaggagaac
gatacaggggatattttgtgggatatgtttgaagtaccagaacttgagaatttcttaaaa
atattggaagatgaggaaaaacaatactgtttccgaattcgacagaaatacgatgcttac
aggtggtttttggatgaaaatttacgtaaccgaggttttactgtagatggtgatgaattt
agctcggtaaaagcaaattcttgtatatccactgatgtttag

DBGET integrated database retrieval system