KEGG   Bacillus pseudomycoides 219298: DJ92_2806Help
Entry
DJ92_2806         CDS       T03239                                 

Gene name
nirD
Definition
(GenBank) nitrite reductase [NAD(P)H], small subunit
  KO
K00363  nitrite reductase (NADH) small subunit [EC:1.7.1.15]
Organism
bmyc  Bacillus pseudomycoides 219298
Pathway
bmyc00910  Nitrogen metabolism
bmyc01100  Metabolic pathways
bmyc01120  Microbial metabolism in diverse environments
Module
bmyc_M00530  Dissimilatory nitrate reduction, nitrate => ammonia
Brite
KEGG Orthology (KO) [BR:bmyc00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    DJ92_2806 (nirD)
Enzymes [BR:bmyc01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.15  nitrite reductase (NADH)
     DJ92_2806 (nirD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rieske_2 Rieske FERM_F1
Motif
Other DBs
NCBI-ProteinID: AIK40731
LinkDB All DBs
Position
complement(2656943..2657260)
Genome map
AA seq 105 aa AA seqDB search
MLQTKEKIKIMHAEDLPVQIGKEVRIKDISIALFRLSNGDIRAVENRCSHKNGPLAEGIV
SGEFVFCPLHDWKISLITGEVQKPDDGCIQTYQVEVIDGDIYIYM
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgttgcaaactaaagaaaaaataaaaataatgcatgcagaagaccttcctgtgcaaatc
ggtaaggaagtgcgcattaaggatatatccatcgccttatttcgcctttcaaatggtgat
attcgcgctgtagaaaatcgatgctctcataaaaacggacctttagccgaaggaattgtt
tctggagaattcgtcttctgtccattgcatgactggaaaatttcattaataacaggtgaa
gttcaaaagcctgatgatggttgtatccaaacatatcaagtagaagttattgatggtgat
atttatatatatatgtaa

DBGET integrated database retrieval system