KEGG   Bacillus mycoides 219298: DJ92_3204Help
Entry
DJ92_3204         CDS       T03239                                 

Gene name
npr
Definition
(GenBank) bacillolysin
  KO
K01400  bacillolysin [EC:3.4.24.28]
Organism
bmyc  Bacillus pseudomycoides 219298
Brite
KEGG Orthology (KO) [BR:bmyc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bmyc01002]
    DJ92_3204 (npr)
Enzymes [BR:bmyc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.28  bacillolysin
     DJ92_3204 (npr)
Peptidases [BR:bmyc01002]
 Metallo Peptidases
  Family M4: thermolysin family
   DJ92_3204 (npr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M4_C Peptidase_M4 FTP PepSY
Motif
Other DBs
NCBI-ProteinID: AIK35930
UniProt: A0A076W2D8
LinkDB All DBs
Position
3071188..3072888
Genome map
AA seq 566 aa AA seqDB search
MKKKSLAFVLAAGMAVTTFGGTSSAFADSKNVLSTKKYNEAVQSPEFISGDLTGATGKKA
ESVVFDYLNAAKGEYKLGEKSAEDSFKVKQVKKDSVTDATVVRMQQVYEGTPVWGSTQLA
HVSKDGSLKVLSGTVVPDLDKKEKLKNKNKIEGKKAIAIAQQDLGLTPKYEVEPSADLYV
YQNGEDTTYAYVVKLNFLEPKPGNYYYFIEAESGKVLNKYNTIDHVNGENQAPLKQENAK
QEGKAVVKPVTGTNKVGTGKGVLGDTKSINTTLSGSTYYLQDNTRGATIFTYDAKNRSTL
PGTLWTDTDNVFNASRDAAAVDAHYYAGVTYDYYKNTFNRNSVNDAGAPLKSTVHYGSNY
NNAFWDGSQMVYGDGDGYTFTSLSGGLDVIGHELTHAVTENSSNLIYQNESGALNEAISD
VFGTLVEYYDNRNPDWEIGEDIYTPGKSGDALRSMSDPAKYGDPDHYSKRYTGSSDNGGV
HTNSGIINKAAYLLANGGTHYGVTVNGIGKDKVGAIYYRANTQYFTESTTFSQARAGLVQ
AAADLYGANSAEVTAVKQTYDAVGVK
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaagagtttagcatttgtattagcggcaggaatggcagttacaacatttgga
gggacaagttctgcatttgcagattcaaagaatgtgctctctacgaaaaagtacaatgaa
gcagtacagtcacctgagtttatctctggagatttgactggagcaactggaaagaaagca
gaatctgttgtatttgattatctaaatgcagcaaaaggagagtataagttaggggaaaag
agtgcagaggattctttcaaagtgaaacaagtgaaaaaagattctgtaactgatgcaaca
gtggtacgtatgcaacaagtatatgaaggtacaccagtatgggggtctactcaactagct
catgttagtaaagatggttcattgaaagttttatctggaacagttgtacctgatttagat
aaaaaggaaaaattaaaaaataaaaataagattgaaggcaaaaaagcaattgcaattgca
cagcaagacttaggattaactccaaaatatgaagtagagccatcagcggatttatatgta
tatcaaaatggtgaggacacaacttatgcatatgttgtgaaattaaacttcttagagcca
aaaccaggaaactattattatttcattgaggcagaaagcggtaaagtattaaataaatac
aatacaattgatcatgtgaatggtgaaaatcaagcaccacttaagcaagaaaatgctaaa
caggaaggtaaagcagttgtaaaacctgttacagggacaaataaagttggaacgggtaaa
ggtgtactaggggatacaaaatctattaatacaacactatctggatctacttattattta
caagataatacacgtggagcaacgattttcacatatgatgcgaaaaatcgctctacattg
ccagggacattatggacagatacagataatgttttcaatgcaagccgtgatgcagctgca
gtagatgctcattattatgcgggtgtaacatatgactattataaaaatacgtttaatcga
aactccgttaatgatgcaggggcgccgttaaaatcaacggtccactacggaagtaattac
aataatgctttctgggacggttcacaaatggtatatggggacggggatggttatacattt
acttcattatcaggtggattagatgtaattgggcatgaattaacgcatgctgttacagaa
aatagttcgaatttaatttatcaaaatgagtcaggtgcgttaaatgaagcgatttctgat
gtttttggtacattagtagaatactatgataatcgtaatccagattgggaaattggtgag
gatatttatacgcctggcaaatcgggagatgcgcttcgctctatgagtgatccagcgaaa
tatggcgatccagatcattattctaaacgttatactggttcaagtgataacggtggtgtt
catacgaacagtggtattattaataaagcggcttacttactagcgaatggtggtacgcat
tacggtgtaacagtaaatggcattggtaaagataaagtaggcgcaatctattatcgtgca
aatacacaatatttcactgaatctactacgtttagtcaagcgcgtgctggcttagtacaa
gcagctgcggatttatatggtgcgaactctgctgaagttacagcggtgaagcagacatat
gatgcagttggtgtaaaatag

DBGET integrated database retrieval system