KEGG   Bacillus pseudomycoides 219298: DJ92_3265Help
Entry
DJ92_3265         CDS       T03239                                 

Definition
(GenBank) zinc-binding dehydrogenase family protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bmyc  Bacillus pseudomycoides 219298
Pathway
bmyc00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bmyc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    DJ92_3265
Enzymes [BR:bmyc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     DJ92_3265
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     DJ92_3265
    1.1.1.-  
     DJ92_3265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc 2-Hacid_dh_C Gp_dh_N TrkA_N
Motif
Other DBs
NCBI-ProteinID: AIK39831
LinkDB All DBs
Position
3138510..3139562
Genome map
AA seq 350 aa AA seqDB search
MKALLWHNQRDVRVEEVPEPTVRSGAVKIKVKWCGICGTDLHEYLAGPIFIPTEEHPLTH
VKAPVILGHEFSGEVVEIGEGVTNHKVGDRVVVEPIYSCGKCEACKHGHYNVCEQLVFHG
LGGDGGGFSEYTVVPADMVHHIPDEMTYEQGALVEPAAVAVHAVRQSKLKEGEAVAVFGC
GPIGLLVIQAAKAAGATPVIAVELSKERQELAKLAGADYVLNPAEQDVVAEIRNLTNGLG
VNVSFEVTGVEVVLRQAIESTSFEGQTVIVSVWEKDATITPNNLVLKEKEVVGILGYRHI
FPSVIKLISSGQIQAEKLITKKITVDQVVEEGFEALVKDKKQVKILVSPK
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattactttggcataatcaacgtgatgtaagagtagaagaagttccagaacca
actgtacgatcaggagcagtgaagatcaaagttaaatggtgtggtatttgtggaacagat
ttacatgaatatttagcaggacctatttttattccaacagaagaacatccactaacacac
gtgaaagcacctgttattttaggtcacgagtttagtggtgaagttgttgaaatcggtgaa
ggtgttacgaatcataaagtaggggaccgcgttgttgtagaacctatttattcttgtggt
aaatgtgaagcttgtaaacatggtcattataacgtttgtgaacaacttgttttccacggt
cttggtggagatggcggtggcttctctgaatatactgtagtaccagcagatatggttcac
catatcccagatgaaatgacttatgaacaaggtgcacttgtagaaccagcagcggttgca
gttcatgcagtgcgtcaaagtaagttaaaagaaggcgaagctgtagctgtatttggctgt
ggaccaatcggacttcttgttatccaagctgctaaagctgcaggtgcaacacctgttatc
gcagttgaactttctaaagaacgtcaagagttagcaaaattagcaggtgctgattacgta
ttaaatccagcagagcaagatgtggtagcagaaatccgtaacttaacaaacggtttaggc
gtaaatgttagcttcgaagtaacaggagttgaagttgtacttcgtcaagcaattgaaagc
acaagctttgaaggacaaactgtaatcgtcagtgtctgggaaaaagatgcgacaattact
ccaaacaacttagtattaaaagaaaaagaagttgtaggtattcttggataccgtcacatc
ttcccatctgttattaaattaattagctctggtcaaattcaagcagagaaattaattacg
aaaaaaattacagtggatcaagttgtagaagaaggatttgaagcgcttgtaaaagataaa
aaacaagtgaaaattcttgtttcacctaaataa

DBGET integrated database retrieval system