KEGG   Bacillus pseudomycoides 219298: DJ92_3464Help
Entry
DJ92_3464         CDS       T03239                                 

Definition
(GenBank) amino acid permease family protein
  KO
K11735  GABA permease
Organism
bmyc  Bacillus pseudomycoides 219298
Brite
KEGG Orthology (KO) [BR:bmyc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bmyc02000]
    DJ92_3464
Transporters [BR:bmyc02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   DJ92_3464
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease AA_permease_2
Motif
Other DBs
NCBI-ProteinID: AIK39204
LinkDB All DBs
Position
3328253..3329668
Genome map
AA seq 471 aa AA seqDB search
MAKEKQELQKDLKTRHITMISIGGVIGGGLFVGSGTIIQSTGPAAILSYIIGALMVVLVM
RMLGEMAAVNPDSGSFSTYAHKAIGPWAGYTIGWLYWFNWLIIIAIEAVLLGVMINNWFP
SIPTWIASLFVIIMMTMTNVYSVKLYGEFEYWLAFIKVVAILAFLVLGVSMIFGLVPNVD
RPDLSMISENGGFFPKGIMPVLLSVVFISFSLSGSEVAAIAAGESDNPEKNVIRAINSVV
WRLMIFFVGSVSILVIFMPWNNAELLKLPYASLFQMAGIPAAAEIMNGVVFLSLLSVMNS
GIYTSSRMLFSLAKKGDAPFIFSKLNSRGTPVWAIYASIIFAFICAMLKFISPDKLFAFL
ANSSGGVTMLMYMFVAVSHIRLRRKAEREDPGKLKVKMWLFPYLTYATLAMIITIFVAQA
FIADMRMQFYMTMLATAVVIAIYFLRDRNKRVPIKEDFTIIQDSKVSLEKE
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
ttggcgaaagaaaaacaagaattgcaaaaagacttaaaaaccagacatatcacgatgatt
tcaattggtggggtaatcgggggcggattatttgtaggaagtgggacaattattcaatca
accggtccagctgccattttgtcctatatcattggtgctttaatggttgtacttgtgatg
cggatgctcggggagatggctgcggtaaaccctgatagtggttcattctcaacatatgca
cataaggcaattggaccttgggcagggtacacaatcggttggttatactggttcaattgg
ctcatcattatcgcaatcgaagcggtattgttaggagtgatgatcaataattggtttcct
tctataccaacatggatagcgagtttgttcgtgattatcatgatgacaatgacaaatgtt
tattcagtgaagttatatggagagtttgaatattggttagcgtttattaaagttgtagcg
attctagcatttttagttttaggagtttctatgatttttggacttgtgcctaatgtagat
agaccggatctttcaatgatctctgaaaacgggggcttttttccaaaaggaattatgcca
gtattacttagcgttgtgtttatttctttctctttatcggggagtgaggtagcggcgatt
gcggccggagagtctgataatccagagaagaatgtaataagagcgattaacagtgttgta
tggcgtcttatgattttctttgtagggtctgtatcgatcttggtcatttttatgccgtgg
aacaatgcagaattattgaaattgccgtatgcaagtttatttcagatggcaggaatccct
gcggctgcggaaattatgaatggggttgtatttctgtcgctcctttcggttatgaattcc
ggaatatacacgagttctcgtatgttattttcacttgcgaaaaagggagacgctcctttt
attttttcaaagttaaacagtagagggacaccagtttgggcgatatatgcaagtatcatc
ttcgcattcatttgcgccatgctaaagtttatatctcctgataaactatttgctttttta
gcgaatagctcaggcggcgttacgatgctgatgtatatgttcgttgccgtttctcatatc
aggttgagaagaaaagctgaaagagaagacccagggaaactaaaggtgaaaatgtggtta
ttcccttatctcacatatgcaacacttgcgatgatcattacgatatttgttgcacaagcg
tttatagcggatatgcgtatgcaattttatatgacgatgttagcaactgccgtagtaatc
gcaatctatttcctaagagatagaaataagcgagtgccaataaaagaagattttacaatt
atacaagattcgaaagttagtttagagaaggagtaa

DBGET integrated database retrieval system