KEGG   Bacillus pseudomycoides 219298: DJ92_381Help
Entry
DJ92_381          CDS       T03239                                 

Definition
(GenBank) D-alanine--D-alanine ligase family protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bmyc  Bacillus pseudomycoides 219298
Pathway
bmyc00473  D-Alanine metabolism
bmyc00550  Peptidoglycan biosynthesis
bmyc01100  Metabolic pathways
bmyc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bmyc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    DJ92_381
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DJ92_381
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    DJ92_381
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bmyc01011]
    DJ92_381
Enzymes [BR:bmyc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     DJ92_381
Peptidoglycan biosynthesis and degradation proteins [BR:bmyc01011]
 Precursor biosynthesis
  Amino acid ligase
   DJ92_381
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 RimK GARS_A CPSase_L_D2 ATPgrasp_ST ATP-grasp ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AIK39343
LinkDB All DBs
Position
complement(341939..342853)
Genome map
AA seq 304 aa AA seqDB search
MRVGVIMGGVSSEKQVSLMTGEEMIAHLDKSKYEVVPIKLNDKKELVEKVRNLDIALLAL
HGEYGEDGTIQGTLETLCVPYTGSVMLSSGICMDKNMSKKMIRYEGIQTPDWIHLSNTEE
LQLDEIDKMGYPLVVKPNSGGSSVGVKIVYDKDSLLSSLEDVFKWDSEIVIEKYIKGEEI
TCSILDGKLLPIISIQHTAEFFDYHAKYDDIATIEEVVELPATTYERVVEAAMTCYRALK
CSVYARVDIIIKDGIPYVMEVNTLPGMTKNSLLPKSAHAAGISYSKLLDMIIETSLQVRK
SEGF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgagagttggcgttattatgggaggcgtgtcttccgaaaaacaagtgtcactcatgaca
ggcgaagaaatgattgcacatttggataagagtaagtatgaagtagtgcctattaaacta
aatgacaaaaaagagcttgttgaaaaggtaagaaatcttgatattgcattgttagcactt
catggagaatatggggaggacggtacgattcaaggtacactagaaactctctgtgttcca
tatactggaagtgtcatgctatcaagcggtatttgtatggataaaaatatgtcgaaaaaa
atgattcgttatgagggcattcaaacaccagattggattcatctttcaaatacggaagag
ctgcagcttgatgaaatagataaaatgggatatccgttagtagtaaaaccaaattcaggt
ggttccagtgtaggggtaaagatcgtatacgataaggattctttactttcttctcttgag
gatgtattcaaatgggattctgaaatagtgattgaaaaatatataaagggcgaagaaatt
acatgttctattttggacggaaagcttttaccaatcatttcgattcaacatacggctgaa
ttttttgattatcatgcgaaatacgatgatatcgctacgattgaagaggttgtggaactt
ccggctacaacatatgaacgtgttgttgaagctgcaatgacctgctatagagcattaaaa
tgcagtgtttatgctagggtggatataattataaaagatggaatcccgtatgtgatggaa
gtgaatacattgccggggatgacaaaaaatagcttgttgcctaaaagtgcccatgcggca
ggaatctcatatagtaagctgttagatatgattatagaaacctcattacaagttagaaag
agcgaaggtttctaa

DBGET integrated database retrieval system