KEGG   Bacillus pseudomycoides 219298: DJ92_3969Help
Entry
DJ92_3969         CDS       T03239                                 

Definition
(GenBank) putative 2-aminoethylphosphonate ABC transport system
  KO
K02012  iron(III) transport system substrate-binding protein
Organism
bmyc  Bacillus pseudomycoides 219298
Pathway
bmyc02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bmyc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    DJ92_3969
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bmyc02000]
    DJ92_3969
Transporters [BR:bmyc02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Iron(III) transporter
    DJ92_3969
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_1 SBP_bac_8 Ago_PAZ LysR_substrate
Motif
Other DBs
NCBI-ProteinID: AIK38994
LinkDB All DBs
Position
3880513..3880974
Genome map
AA seq 153 aa AA seqDB search
MELYIRKIKGERKSEKTLCKAVATGGIFSLLMGCGTKKEETAGAKVKDDKLSESLAVYTA
IEEELVPIYLDSFKKKYPDVKLNIVRDSTGVITAKLLAEGKNTQADVVWGTAASSLLALE
KKEMLKEYSPKGVDRVLPQFKDDKKPEKWIRDD
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
ttggagttgtacataagaaaaataaaaggagagagaaaaagtgaaaaaacactctgtaaa
gctgtagcaaccgggggaatattttctttattaatgggatgtggtactaagaaagaagaa
actgctggggcgaaagtgaaagatgacaaactgtctgaatcattagcagtttacacagca
attgaagaagaacttgtacctatttatcttgattcctttaaaaagaaatacccagatgtg
aaattaaatattgttcgtgattcaacaggggttattacagcgaaattgttagcagaaggg
aaaaatacacaagcagatgttgtatggggaacagcagcttctagtcttttagctctagaa
aagaaagaaatgttgaaagaatactctccaaaaggtgtagatcgtgtacttccgcaattt
aaagatgataaaaagccagaaaaatggattcgcgacgattaa

DBGET integrated database retrieval system