KEGG   Bacillus mycoides 219298: DJ92_4643Help
Entry
DJ92_4643         CDS       T03239                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bmyc  Bacillus mycoides 219298
Pathway
bmyc00473  D-Alanine metabolism
bmyc01100  Metabolic pathways
bmyc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bmyc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    DJ92_4643 (alr)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    DJ92_4643 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bmyc01011]
    DJ92_4643 (alr)
Enzymes [BR:bmyc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     DJ92_4643 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:bmyc01011]
 Precursor biosynthesis
  Racemase
   DJ92_4643 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C adh_short_C2
Motif
Other DBs
NCBI-ProteinID: AIK37361
UniProt: A0A076W3S4
LinkDB All DBs
Position
4524028..4525203
Genome map
AA seq 391 aa AA seqDB search
MSSRYGRDTIVEVNLDAVKHNVREFKKRVNDKNIAMMAAVKANGYGHGAVEVAKAAIEAG
VNQLAVAFVDEGIELREAGVTVPILVLGYTPVDVAKDAIGYDIMMTVYRIEDLKGINEIA
KQLEKKAHIQVKIDTGMSRIGLQEEEVAPFLEELKNMKYIEIEGMFTHYSTADEINKTYT
NMQTSLFEKAVNTAKEMDIHLPYIHSSNSAGSMELSNTFQNMVRVGIGIYGMYPSKEVDH
TVVSLQPALSLKSKLAHIKHAKKNRGVSYGNTYVTTGEEWIATVPIGYADGYNRQLSNKG
HALINGIRVPVLGRVCMDQLMLDVTKAMPVQVGDEVVFYGRQGEEEISVEEIADTLGTIN
YEVTCMLDRRIPRVYKENDETTTVVNILRNK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagttcgagatatggaagagatacaattgttgaagttaacttagatgctgtaaaacat
aatgtaagagaatttaaaaaacgtgtgaatgataaaaatattgcaatgatggcagcggta
aaagcaaatgggtatggacacggggcggttgaagttgcaaaagcggcaattgaggcagga
gtgaatcaacttgctgttgcttttgtagatgaaggaatcgaactacgcgaagcaggagtt
actgtgccgattttagttttaggttatacaccagtggatgttgctaaagatgctattggg
tatgatattatgatgacggtatatagaatagaggatctaaaaggtatcaatgaaattgct
aagcaacttgaaaagaaagcgcatattcaagtgaaaatagatacaggaatgagtcgcatt
ggtttacaagaagaagaggttgcgccatttttagaagaactaaaaaatatgaaatatata
gaaatagaaggtatgtttacacattactctacagctgatgaaattaataaaacatataca
aatatgcaaacgagtttatttgagaaagctgtaaatacagcgaaggaaatggatattcat
cttccgtatatccatagttcaaacagtgctggatcaatggagctaagcaatacatttcaa
aatatggttcgtgttggaatcgggatttatggtatgtatccttcgaaagaagtagatcat
acagttgtttctttacagccagcactatcattgaagtcgaaactggctcatattaagcac
gcgaaaaaaaatcgtggtgtaagttatgggaatacgtatgtaacaacaggagaagaatgg
attgcgactgttccaattggttatgcagatgggtataaccgtcagctgtcgaataagggg
catgcgttaattaatggaattcgtgtaccagttcttgggcgcgtttgtatggaccagtta
atgttagatgttacaaaagcaatgcctgtacaagtaggagatgaagttgttttctacggt
agacaaggtgaggaagaaatttctgtagaagaaatcgcggatacattgggtacaattaac
tatgaagtgacttgtatgctagatcgaagaattccacgcgtatataaagaaaatgatgaa
acgactactgttgtgaatatattaagaaacaaatga

DBGET integrated database retrieval system