KEGG   Bacillus mycoides ATCC 6462: BG05_123Help
Entry
BG05_123          CDS       T03798                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bmyo  Bacillus mycoides ATCC 6462
Brite
KEGG Orthology (KO) [BR:bmyo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BG05_123 (ahpF)
Enzymes [BR:bmyo01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BG05_123 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA HI0933_like FAD_oxidored FAD_binding_3 Thi4 DAO AlaDh_PNT_C K_oxygenase NAD_binding_8 Glutaredoxin Thioredoxin_4
Motif
Other DBs
NCBI-ProteinID: AJH19240
UniProt: J8I4T0
LinkDB All DBs
Position
133728..135254
Genome map
AA seq 508 aa AA seqDB search
MILDADIKTQLSQYLQLMENDILLKVSAGDDNVSKDMLSLVDELATMSSKITVEKVELER
TPSFSVNRPGEETGVVFAGIPLGHEFTSLVLALLQVSGRAPKVEQKLIDQIKNIQGEYHF
ESYISLSCHNCPDVVQALNVMSVLNSGITHTMIDGAAFKEEVESKDIMAVPTVYLNGESF
GSGRMTLEEILAKMGNGPDASELSDKDPYDVLVVGGGPAGASAAIYAARKGIRTGIVAER
FGGQVMDTMGIENFISVKRTEGPKLVASLEEHVKEYDIDVMNLQRAKRLEKKELIEVELE
NGAILKSKSVIVSTGARWRNVGVPGEAEFKNKGVAYCPHCDGPLFIGKDVAVIGGGNSGI
EAAIDLAGIVKHVTVLEFMPELKADAVLQERLNSLPNVTVLKNVQTKEITGTDKVNGISY
IDRETEEVHHVELQGVFVQIGLVPNTDWLGETVERVRGEIVTDKHGATNVPGVFGAGDCT
NNPYKQIIISMGSGANAALGAFDYLIRN
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgatactagatgcagatataaaaacacaactatcccaataccttcagttaatggagaac
gatattttacttaaagtaagcgcaggagacgataacgtatctaaagatatgttatctcta
gtagatgaattagctactatgtcatctaagattacagtagaaaaagttgaactagagaga
acaccaagctttagcgtaaatcgccctggtgaagaaactggtgtcgtattcgctggtatt
ccattaggacacgaatttacttcattagtgttagctttactacaagttagtggacgtgct
ccaaaagttgaacaaaaattaatcgatcaaatcaaaaacattcaaggcgaatatcatttt
gaatcttatatcagcctaagttgtcataactgtcctgatgttgtacaagctcttaacgtg
atgagcgttctaaactctggtattacacatactatgattgatggcgctgcatttaaagag
gaagtagaaagtaaagacatcatggcagtaccaactgtttacctaaatggcgaatctttc
ggaagcggtcgtatgacacttgaagaaattttagctaaaatgggtaacggtccagatgca
tcagagctttctgataaagatccatacgatgttcttgttgttggtggcggcccagctggt
gcaagtgcagcaatttatgcagcacgtaaaggcatccgcactggtatcgttgctgagcgc
ttcggtggtcaagtaatggatactatgggtattgagaacttcatcagcgtaaaacgcact
gaaggtcctaagctagtagcaagccttgaagagcacgtaaaagaatacgacatcgatgta
atgaatctacaacgtgcgaaacgtttagagaaaaaagaacttattgaagtggaacttgaa
aacggcgctattctgaaaagtaagagcgtaatcgtttcaacaggtgctcgctggcgtaat
gttggcgtaccgggtgaagctgagttcaaaaacaaaggtgtagcatactgcccacactgt
gacggtccattattcatcggaaaagatgtagcggttatcggcggtggtaactctggtatt
gaagcagctatcgacttagcaggtattgttaagcacgtaactgttcttgaattcatgcca
gaattaaaagctgatgctgtattacaagaacgtcttaacagcttaccaaacgtaactgtt
ctgaaaaacgttcaaacgaaagaaatcactggtactgataaagtaaacggtatttcttac
atcgatcgtgaaactgaagaagtacaccatgttgaattacaaggtgtattcgttcaaatc
ggtcttgtgccaaacacagactggttaggcgaaacagttgaacgcgttcgcggtgaaatc
gtaacagacaagcacggcgctacaaacgtaccaggagtgtttggtgcaggtgactgtaca
aataatccgtacaaacaaatcatcatctctatgggttcaggtgcgaatgcagctttaggt
gcatttgattacttaatccgtaactaa

DBGET integrated database retrieval system