KEGG   Bacillus mycoides ATCC 6462: BG05_2162Help
Entry
BG05_2162         CDS       T03798                                 

Gene name
prkC
Definition
(GenBank) serine/threonine-protein kinase PrkC
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bmyo  Bacillus mycoides ATCC 6462
Brite
KEGG Orthology (KO) [BR:bmyo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bmyo01001]
    BG05_2162 (prkC)
Enzymes [BR:bmyo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BG05_2162 (prkC)
Protein kinases [BR:bmyo01001]
 Serine/threonine kinases: Other
  Bacterial family
   BG05_2162 (prkC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kinase-like RIO1 Haspin_kinase Fructosamin_kin Kdo
Motif
Other DBs
NCBI-ProteinID: AJH19212
UniProt: A0A084J430
LinkDB All DBs
Position
2046306..2048279
Genome map
AA seq 657 aa AA seqDB search
MLIGKRLNDRYKLLKMIGGGGMANVYLAHDDILGRDVAVKILRLDYSNNEEFIKRFHREA
QSVTTLSHPNIVNMYDVGEEDDIYYLVMEYVPGRTLKQYIIDRGMLPIGEALDIMEQLTS
AMAHAHHFEIVHRDIKPHNILIRDDGVVKVTDFGIATATSAATITHTNSVLGSVHYLSPE
QARGGIANKQSDIYSLGIVMFELLTGRQPFSGESAVAIALKHLQNEMPSPKRWNDNIPQS
VENIILKATAKDPFHRYQSANAMKRDIETALYPERINEQPFYIPEDMEATKAIPIIQQEQ
LFQNVSDETIVLKGSKVDEQVRKEETKSGKKKKRNNKWLKVLITTFLLLAIGITLALTVI
PGFFIPKDVKVPDVAGMKYTTAVNTLVEKGFEVTEPNLVYTDDVEAGKVIKTDPIAGRVV
KENSKITIYQSGGKKKSKMRDLTGKDFESIRAELEEEYKQVTINYIENDKPKGEIVEQIP
TPDQMVIETEQELKIWVSKGPYQIRPGDFSGWTENSVKGYLNERKLVSDIKREYSDTVDK
GLVISQLPKPGTPLKEGDKVSIVISDGPKPKVTKTVKVDNISIPYEASATGEKKPQTIEI
YKEDMQQKMDKPVETRTITESAIISLEFVIQEGAKGHYKIVRDGVTIMDKEVPYPAQ
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
gtgctgattggaaaacgcttaaatgaccgttataagctgctgaaaatgattggcggtgga
ggaatggccaatgtatatttagctcatgatgatatactcggccgagatgtagcggtaaaa
atattaagactcgactattcaaataatgaagagtttattaaacgtttccatcgagaagcg
caatctgttacaacgttgtcgcatccaaatattgtgaatatgtatgatgttggggaagag
gatgatatatattatcttgtaatggaatatgtacctggacgaacattgaagcaatacata
attgatcgagggatgttaccgataggagaggctcttgatataatggagcagttaacgtcc
gctatggcacacgcccatcattttgagattgtacatcgtgatattaaaccgcacaatatt
ttgattcgagatgacggagtggtcaaagtaacagactttggaattgcgacagctacaagt
gcagcaacaattacacatacaaattcggtgctcggttcggtgcattatttatcaccagaa
caagcgcgcggcggtatagcgaataaacaatcagatatttattcacttgggattgttatg
tttgaattgttaacaggaagacaaccgttttctggtgaatctgctgttgcaattgcgtta
aaacatttacaaaatgaaatgccatctccaaaaagatggaatgacaatattccacaaagt
gttgaaaatattatattaaaggcaactgcgaaagatccgttccatcgatatcaatctgct
aacgcgatgaaacgagatattgaaacagcactatacccagaacgaataaatgaacaacca
ttttacataccagaagatatggaagcaacgaaagcgattccaattattcaacaagaacaa
ctatttcaaaatgtaagtgatgaaacgattgtattaaaaggaagtaaagtggatgaacaa
gtaagaaaagaagagaccaaatcaggtaagaagaaaaagcgaaataataaatggctgaaa
gttttaattacaacatttttacttttagcgatagggataacattagcacttactgttatt
ccaggcttctttattccgaaagatgtgaaggttcctgatgtggctggtatgaaatatacg
acagctgtaaatacattagttgaaaaaggttttgaagttactgaacctaatcttgtatat
acagatgatgttgaagccggaaaagtgataaaaacagatcctatagcaggaagagtagtg
aaagaaaactctaaaattactatctatcaatcaggtgggaaaaagaaaagtaagatgcgt
gatttgacaggaaaagatttcgagagtataagagctgagttagaagaagaatataaacaa
gttacaataaattatattgaaaatgataagccgaaaggtgaaattgtagagcaaatacca
acgcctgatcaaatggttatagagacagaacaagaactgaaaatttgggtaagtaaagga
ccttatcaaataagaccaggtgatttttcaggatggactgaaaatagtgtaaaaggttat
ttaaatgaaagaaagcttgtttctgatataaaaagagagtattcagatacggttgataaa
ggtcttgttatttcacagttaccaaagcctgggacacctttaaaagaaggagataaagta
tcgattgttatctccgatggtccgaagcctaaagtgacgaaaacggtaaaagtggataac
atttctatcccatatgaagcttctgcaacaggtgagaaaaagccgcaaacaatagaaatt
tataaagaagatatgcagcaaaaaatggataaaccagttgaaacgagaacaattactgag
tcagcgattatttctttagaatttgtaattcaagaaggtgcaaagggacactataaaatt
gtccgagatggagtaacgattatggacaaggaagtaccatatccagctcaataa

DBGET integrated database retrieval system