KEGG   Bacillus mycoides ATCC 6462: BG05_4847Help
Entry
BG05_4847         CDS       T03798                                 

Definition
(GenBank) FAD dependent oxidoreductase family protein
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bmyo  Bacillus mycoides ATCC 6462
Pathway
bmyo00564  Glycerophospholipid metabolism
bmyo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bmyo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BG05_4847
Enzymes [BR:bmyo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BG05_4847
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 NAD_binding_8 GIDA
Motif
Other DBs
NCBI-ProteinID: AJH18786
UniProt: A0A0B5S0E9
LinkDB All DBs
Position
complement(4686108..4687790)
Genome map
AA seq 560 aa AA seqDB search
MKFSSKQRKDVLNGVNKQELDVIVIGGGITGSGIALDGATRGLSTIVFEMQDFAAGTSSR
STKLVHGGLRYLKQLEVKMVAEVGKERAIVYENGPHVTTPEWMLLPFHTGGTFGSFSTSI
GLRVYDFLAGVKRSERRKMFNREETLNKEPLVKQEGLKGGGYYVEYRTDDARLTIEVMKE
AIEHGAKAVNYAKVDSFLYKDGKVCGVRVIDLLDGEVYEVYGKKIVNAAGPWVDTLREKD
NSKKGKVLQLSKGVHLVIDQKRFPLGQAIYFDTPDKRMVFAIPREGKTYVGTTDTFYDKD
AAVPHMTTEDRTYIINAINYMFPSVKITEKDVESSWAGVRPLIYEEGKNASEISRKDEIW
TSESGLITIAGGKLTGYRKMAEMVVDYVTNLLQKEGHSAYKKSDTKHMPISGGHVSGSHG
FPAFVAKKAGEGTKYGLTTAQAEKFAEFYGSNVDVLFDLAKKHKDEAKEYNMPLDVLIPL
VYAMDYEMTVKPVDFFVRRRGAVFFNIHWVYEWKEAVINYMAAKLGWSKEEQMKYTAELE
KALSDAVIPVDQQEQAAALA
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgaaattttcaagtaaacaacgtaaagacgtattaaatggagtaaataaacaagagtta
gatgtgatcgtaattggtggaggtattactggttctggtattgcattagatggggcaaca
cgcggtttatcaacgattgtgtttgaaatgcaggactttgcagcaggtacatcaagtcgt
tcaacgaaacttgtacacggcggtttacgttatttaaaacaacttgaagtgaaaatggta
gcagaggtggggaaagagcgtgcgatcgtatatgagaacggtccccatgtaacaacaccg
gagtggatgttacttccgttccatacaggcggcacgttcgggtcattcagtacatcaatt
ggtcttcgtgtatacgacttcttagcaggtgtaaaacgaagcgagcgcagaaagatgttt
aaccgtgaagaaacgctaaataaagagcctcttgtaaaacaagaaggattaaaaggcggc
ggttactacgtagaatatcgtacagacgatgcgcgtcttacaattgaagtaatgaaagaa
gcgattgaacatggtgcgaaagctgttaactacgcaaaagtagacagtttcttatataaa
gatggaaaagtatgcggtgtacgtgtaatcgatttactagacggagaagtgtatgaagtt
tacggtaagaaaattgtaaacgcagctggtccttgggtagatacacttcgtgaaaaagat
aactctaaaaaagggaaagtacttcagttatcaaaaggtgtgcatttagtaattgaccaa
aaacgtttcccattagggcaagcaatttactttgatacaccagataaacgtatggtgttc
gcgattcctcgcgaaggaaaaacgtacgtaggtacaacagatacgttctatgataaagac
gcagctgtaccgcacatgacaacagaagatcgcacatatatcattaatgcgattaattac
atgttcccaagcgtgaaaattacagaaaaagatgtggaatcaagctgggctggtgtacgt
ccgctaatttatgaagaaggtaagaatgcatctgaaatttctcgtaaagatgaaatttgg
acttctgaatctggtttaattacaatcgcgggcggtaaattaacaggataccgcaaaatg
gctgaaatggtagtagactacgtaacgaatctattacaaaaagaaggccatagcgcatat
aagaagagtgatacgaaacatatgccaatctctggtggtcatgtaagtggttcacacgga
ttcccggcatttgttgcgaaaaaagcaggcgaaggtacgaaatatggtttaacgacagca
caagcggaaaaattcgcggaattctacggctctaacgttgacgtactgtttgacttagcg
aaaaaacataaagacgaagcgaaagaatacaacatgccgctagacgttctaatcccactt
gtatacgcaatggattacgaaatgacagtgaaaccagttgacttcttcgtacgccgcaga
ggcgctgtattcttcaacatccactgggtatacgagtggaaagaagcagtaatcaactac
atggctgcgaaactaggctggagcaaagaagagcaaatgaaatacacagctgaattagaa
aaagcgttaagcgatgctgtaattcctgtagatcaacaagagcaggcagctgcgttagcg
taa

DBGET integrated database retrieval system