KEGG   Bacillus mycoides ATCC 6462: BG05_4918Help
Entry
BG05_4918         CDS       T03798                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
bmyo  Bacillus mycoides ATCC 6462
Pathway
bmyo00250  Alanine, aspartate and glutamate metabolism
bmyo00650  Butanoate metabolism
bmyo01100  Metabolic pathways
bmyo01110  Biosynthesis of secondary metabolites
bmyo01120  Microbial metabolism in diverse environments
bmyo02024  Quorum sensing
Module
bmyo_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:bmyo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BG05_4918
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BG05_4918
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BG05_4918
   00430 Taurine and hypotaurine metabolism
    BG05_4918
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BG05_4918
Enzymes [BR:bmyo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     BG05_4918
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AJH17760
UniProt: A0A0B5RSP1
LinkDB All DBs
Position
complement(4750854..4752323)
Genome map
AA seq 489 aa AA seqDB search
MPQDRKAEAQNDAYEGKEIMPDNLQYLPRHVQMELPHEFSVNPLFAREGESVVPRFHMPD
EGMLPETAYQIVHDEIALDGNARLNLATFVSTWMEPAAEHLYAKSFDKNMIDKDEYPQTA
EIEERCVRILANLWHSPTPLTTMGVSTTGSSEACMLGGLALKRRWQNARKSEGKPVDRPN
IVFSSAVQVVWEKFANYWEVEPRYVKVSPEHPRLDPQGVLAAVDENTIGVVPILGETYTG
GYEPVAAIAKALDDLQERTGLDIPMHVDAASGGFIAPFLQPDLVWDFQLPRVKSINVSGH
KYGLVYPGLGWIIWREAEDLPEDLIFRVSYLGGNMPTFALNFSRPGAQVLLQYYNYLRLG
KSGYYDVQRASQKVALFLSKAIQKMEPFELLSDGSDIPVFAWRLKDGYTLNWNLYDLSRQ
LRVFGWQVPAYPLPPDMEAVTIMRVVVRNGFSMDLAHLFLRNLKQTVAFLDSLDGPMPHD
TKCDNGFHH
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgccacaggatcgaaaagcagaagctcaaaacgatgcatacgaaggaaaagagatcatg
ccagataatctacaatatctaccgcgtcacgtgcaaatggagctgcctcacgaattttca
gtaaatcctctgtttgcccgcgaaggagaatcagtcgttccgcgctttcacatgcctgat
gaaggcatgttaccagaaacagcgtatcaaatcgtccatgatgaaattgctcttgatggc
aatgcccgcttgaatcttgcaacattcgttagcacatggatggagcctgccgcagagcac
ttatatgccaaatcattcgacaagaacatgattgacaaggatgaatatccacagacagcc
gaaattgaggagcggtgtgtccgcattttagcaaacctctggcattcgcccactcccctt
acgactatgggcgtttcaacaactggatcgtcggaagcatgtatgctcggggggcttgcg
ttaaagagacgctggcaaaatgcacgcaaaagcgaagggaagccggtggatcggcccaat
attgtgtttagttctgctgttcaagttgtgtgggaaaaattcgcgaactattgggaggtt
gaaccacgctatgtgaaggttagccctgagcatccccgattggatcctcagggggtcctc
gctgccgtggatgaaaatacgattggtgtggtaccgattctcggtgagacttataccggg
ggttacgagccggttgccgccattgcgaaagcgttggacgatttacaggagaggacaggc
ctcgacattcccatgcatgtggatgcggcttcggggggatttatagcaccgtttcttcaa
ccagatttagtctgggattttcaattaccgagggtgaagtccatcaatgtatccggacat
aaatatggattagtctaccctgggttgggttggataatttggcgggaagctgaagatctc
cctgaggatctaatcttccgcgtctcctatttgggcgggaacatgccgacttttgccctg
aatttctctcgtcctggcgcacaagtgctcctgcaatattacaattacctgcgtttgggg
aaaagtgggtactatgatgtccaaagggcttctcagaaagtcgctctttttcttagcaag
gcgattcagaagatggaaccgttcgaacttttgtccgatggttcggatattccggttttc
gcttggcgactgaaagatggttacacattaaactggaatctttatgatttatctcgacaa
ttgcgtgtgttcggctggcaagtacccgcttatccattgcctccagatatggaagcggtg
acgattatgcgcgttgtggttcgaaatggattttccatggatctcgcgcatttatttttg
aggaacctcaaacagaccgttgcctttctggattccctggacgggcctatgccacatgat
acgaaatgtgataatgggtttcatcactaa

DBGET integrated database retrieval system