KEGG   Bacillus mycoides ATCC 6462: BG05_4918Help
Entry
BG05_4918         CDS       T03798                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
bmyo  Bacillus mycoides ATCC 6462
Pathway
bmyo00250  Alanine, aspartate and glutamate metabolism
bmyo00410  beta-Alanine metabolism
bmyo00430  Taurine and hypotaurine metabolism
bmyo00650  Butanoate metabolism
bmyo01100  Metabolic pathways
bmyo01110  Biosynthesis of secondary metabolites
bmyo01120  Microbial metabolism in diverse environments
bmyo02024  Quorum sensing
Module
bmyo_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:bmyo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BG05_4918
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BG05_4918
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BG05_4918
   00430 Taurine and hypotaurine metabolism
    BG05_4918
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BG05_4918
Enzymes [BR:bmyo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     BG05_4918
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AJH17760
UniProt: A0A0B5RSP1
LinkDB All DBs
Position
complement(4750854..4752323)
Genome map
AA seq 489 aa AA seqDB search
MPQDRKAEAQNDAYEGKEIMPDNLQYLPRHVQMELPHEFSVNPLFAREGESVVPRFHMPD
EGMLPETAYQIVHDEIALDGNARLNLATFVSTWMEPAAEHLYAKSFDKNMIDKDEYPQTA
EIEERCVRILANLWHSPTPLTTMGVSTTGSSEACMLGGLALKRRWQNARKSEGKPVDRPN
IVFSSAVQVVWEKFANYWEVEPRYVKVSPEHPRLDPQGVLAAVDENTIGVVPILGETYTG
GYEPVAAIAKALDDLQERTGLDIPMHVDAASGGFIAPFLQPDLVWDFQLPRVKSINVSGH
KYGLVYPGLGWIIWREAEDLPEDLIFRVSYLGGNMPTFALNFSRPGAQVLLQYYNYLRLG
KSGYYDVQRASQKVALFLSKAIQKMEPFELLSDGSDIPVFAWRLKDGYTLNWNLYDLSRQ
LRVFGWQVPAYPLPPDMEAVTIMRVVVRNGFSMDLAHLFLRNLKQTVAFLDSLDGPMPHD
TKCDNGFHH
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgccacaggatcgaaaagcagaagctcaaaacgatgcatacgaaggaaaagagatcatg
ccagataatctacaatatctaccgcgtcacgtgcaaatggagctgcctcacgaattttca
gtaaatcctctgtttgcccgcgaaggagaatcagtcgttccgcgctttcacatgcctgat
gaaggcatgttaccagaaacagcgtatcaaatcgtccatgatgaaattgctcttgatggc
aatgcccgcttgaatcttgcaacattcgttagcacatggatggagcctgccgcagagcac
ttatatgccaaatcattcgacaagaacatgattgacaaggatgaatatccacagacagcc
gaaattgaggagcggtgtgtccgcattttagcaaacctctggcattcgcccactcccctt
acgactatgggcgtttcaacaactggatcgtcggaagcatgtatgctcggggggcttgcg
ttaaagagacgctggcaaaatgcacgcaaaagcgaagggaagccggtggatcggcccaat
attgtgtttagttctgctgttcaagttgtgtgggaaaaattcgcgaactattgggaggtt
gaaccacgctatgtgaaggttagccctgagcatccccgattggatcctcagggggtcctc
gctgccgtggatgaaaatacgattggtgtggtaccgattctcggtgagacttataccggg
ggttacgagccggttgccgccattgcgaaagcgttggacgatttacaggagaggacaggc
ctcgacattcccatgcatgtggatgcggcttcggggggatttatagcaccgtttcttcaa
ccagatttagtctgggattttcaattaccgagggtgaagtccatcaatgtatccggacat
aaatatggattagtctaccctgggttgggttggataatttggcgggaagctgaagatctc
cctgaggatctaatcttccgcgtctcctatttgggcgggaacatgccgacttttgccctg
aatttctctcgtcctggcgcacaagtgctcctgcaatattacaattacctgcgtttgggg
aaaagtgggtactatgatgtccaaagggcttctcagaaagtcgctctttttcttagcaag
gcgattcagaagatggaaccgttcgaacttttgtccgatggttcggatattccggttttc
gcttggcgactgaaagatggttacacattaaactggaatctttatgatttatctcgacaa
ttgcgtgtgttcggctggcaagtacccgcttatccattgcctccagatatggaagcggtg
acgattatgcgcgttgtggttcgaaatggattttccatggatctcgcgcatttatttttg
aggaacctcaaacagaccgttgcctttctggattccctggacgggcctatgccacatgat
acgaaatgtgataatgggtttcatcactaa

DBGET integrated database retrieval system