KEGG   Bacillus mycoides ATCC 6462: BG05_673Help
Entry
BG05_673          CDS       T03798                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
bmyo  Bacillus mycoides ATCC 6462
Pathway
bmyo00240  Pyrimidine metabolism
bmyo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmyo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    BG05_673 (tdk)
Enzymes [BR:bmyo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     BG05_673 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_14 DZR UvrD-helicase
Motif
Other DBs
NCBI-ProteinID: AJH17839
UniProt: A0A084IYQ9
LinkDB All DBs
Position
659677..660261
Genome map
AA seq 194 aa AA seqDB search
MYLMNQNGWIEVICGSMFSGKSEELIRRIRRTQFAKQHAIVFKPCIDNRYSEEDVVSHNG
LKVKAVPVSASKDIFNHVTEEMDVIAIDEVQFFDGDIVEVVQVLANRGYRVIVAGLDQDF
RGLPFGQVPQLMAIAEHVTKLQAVCSECGSPASRTQRLIDGEPAAFDDPIILVGASESYE
PRCRHCHAVPTKQR
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgtacttaatgaatcaaaatggttggattgaagtgatttgcgggagtatgttttctgga
aaatcagaagagctcatccgccgtatacgccgtacacaatttgcgaaacaacatgcaatt
gtatttaaaccatgtattgataatcgttatagtgaagaagatgttgtatcacataatgga
ttaaaggttaaagcagttcctgtttcagcttcaaaagatatatttaaccatgtaacagaa
gaaatggatgttattgcaatcgatgaggtacaattttttgatggggacattgtggaagtg
gtgcaagtattggcaaatcgtggctatcgtgtcattgtagctggattagaccaagatttc
cgtggtctaccatttggacaagttcctcagctgatggcgattgctgaacatgtaactaaa
ttgcaggcagtttgttctgaatgtggatctcctgcaagtcgtacgcaacgtttaatcgat
ggagaaccagcggcatttgatgatccaattattttagttggggcttcagaatcgtatgaa
ccacgttgtcgtcattgtcatgcagtacctacaaaacaaagataa

DBGET integrated database retrieval system