KEGG   Bacillus mycoides ATCC 6462: BG05_698Help
Entry
BG05_698          CDS       T03798                                 

Gene name
atpD
Definition
(GenBank) ATP synthase F1, beta subunit
  KO
K02112  F-type H+/Na+-transporting ATPase subunit beta [EC:7.1.2.2 7.2.2.1]
Organism
bmyo  Bacillus mycoides ATCC 6462
Pathway
bmyo00190  Oxidative phosphorylation
bmyo01100  Metabolic pathways
Module
bmyo_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:bmyo00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BG05_698 (atpD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:bmyo00194]
    BG05_698 (atpD)
Enzymes [BR:bmyo01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.1.2.2  H+-transporting two-sector ATPase
     BG05_698 (atpD)
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.1  Na+-transporting two-sector ATPase
     BG05_698 (atpD)
Photosynthesis proteins [BR:bmyo00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   BG05_698 (atpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_ab ATP-synt_ab_N RsgA_GTPase ATPase_2 AAA ABC_tran NB-ARC NACHT AAA_19 T3SS_ATPase_C AAA_22 ATPase AAA_16 AAA_7 RNA_helicase AAA_30 TrwB_AAD_bind
Motif
Other DBs
NCBI-ProteinID: AJH21395
UniProt: A0A0B5S2X5
LinkDB All DBs
Position
679537..680946
Genome map
AA seq 469 aa AA seqDB search
MNKGRVTQIMGPVVDVKFDGGKLPEIYNALTVKQSNENGASINLTFEVALHLGDDTVRTV
AMSSTDGLVRGTEVEDTGKAISVPVGDVTLGRVFNVLGDAIDLDGDVPADVRRDPIHRQA
PAFEELSTKVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHGGI
SVFAGVGERTREGNDLYHEMSDSGVIKKTAMVFGQMNEPPGARQRVALTGLTMAEHFRDE
QGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTNKGSITS
IQAVYVPADDYTDPAPATTFAHLDATTNLERRLTQMGIYPAVDPLASTSRALSPEIVGEE
HYGVARQVQQTLQRYKELQDIIAILGMDELSEEDKLVVHRARRIQFFLSQNFHVAEQFTG
QKGSYVPVKNTVSGFKEILEGKYDDLPEDAFRLVGSIEEVIENAKKMMA
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagggcgcgttacgcaaatcatgggtccggttgtagacgttaagtttgatggc
ggaaagctaccagaaatctacaacgcccttacggtaaaacaaagcaacgaaaacggagca
agcattaacttaacatttgaagttgcacttcatttaggtgatgacacagttcgtacagtt
gcaatgtcttccacagatggacttgttcgtggcacagaagtagaagatactggtaaagca
atctctgtaccagttggtgatgtaacacttggtcgtgtatttaacgtattaggtgatgca
attgacttagatggtgatgttcctgcggatgtacgtcgtgatccaattcaccgtcaagcg
cctgcattcgaagagttatctactaaagtagaaattcttgaaactggtattaaagtagta
gacttacttgctccttacattaagggtggtaagattggtctattcggtggtgccggcgta
ggtaaaacagtattaattcaggaattaattaataacatcgcacaagagcacggtggtatc
tctgtattcgctggtgtaggtgagcgtactcgtgaaggtaacgacttataccacgaaatg
agcgattctggcgtaattaagaaaactgcgatggtattcggacaaatgaacgagccacct
ggagcacgtcaacgtgttgcattaacaggtttaacaatggctgaacatttccgtgatgag
caaggacaagacgtactattgttcatcgataacatcttccgtttcacgcaagcgggttct
gaagtatctgcccttcttggtcgtatgccatctgcggtaggttaccagccaacacttgca
acagaaatgggtcaattacaagagcgtattacatctacaaataaaggatctatcacgtct
atccaagcggtatacgtaccagccgatgactatacggatccagcaccagctacaacgttc
gctcacttagatgcaacaacaaacttagagcgtcgtttaacacaaatgggtatttaccca
gccgtagatccattagcatctacatctcgtgcgctttctccagaaatcgtaggagaagag
cattatggagtagctcgtcaagtacagcaaactttacagcgttataaagagcttcaagat
atcatcgctatcttaggtatggatgagttatctgaagaagataagttagttgtacatcgt
gctcgtcgtattcaattcttcttatcacaaaacttccacgtagctgaacagtttacaggt
caaaaaggttcttacgtacctgtaaaaaatacagttagtggtttcaaagaaattctagaa
ggaaaatatgatgaccttccagaagatgcgttccgtcttgttggtagcattgaagaagtt
attgaaaacgcgaagaaaatgatggcgtaa

DBGET integrated database retrieval system