KEGG   Brucella melitensis M28: BM28_A1246Help
Entry
BM28_A1246        CDS       T01852                                 

Gene name
tuf-2
Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
bmz  Brucella melitensis M28
Brite
KEGG Orthology (KO) [BR:bmz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bmz03012]
    BM28_A1246 (tuf-2)
   03029 Mitochondrial biogenesis [BR:bmz03029]
    BM28_A1246 (tuf-2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bmz04147]
    BM28_A1246 (tuf-2)
Translation factors [BR:bmz03012]
 Eukaryotic Type
  Elongation factors
   BM28_A1246 (tuf-2)
 Prokaryotic Type
   BM28_A1246 (tuf-2)
Mitochondrial biogenesis [BR:bmz03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BM28_A1246 (tuf-2)
Exosome [BR:bmz04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BM28_A1246 (tuf-2)
  Exosomal proteins of breast cancer cells
   BM28_A1246 (tuf-2)
  Exosomal proteins of colorectal cancer cells
   BM28_A1246 (tuf-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ADZ66322
LinkDB All DBs
Position
1:complement(1220595..1221770)
Genome map
AA seq 391 aa AA seqDB search
MAKSKFERTKPHVNIGTIGHVDHGKTSLTAAITKFFGEFKAYDQIDAAPEERARGITIST
AHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQ
VGVPAIVVFLNKCDQVDDAELLELVELEVRELLSKYEFPGDEIPIIKGSALAALEDSSKE
LGEDAIRNLMDAVDSYIPTPERPIDQPFLMPIEDVFSISGRGTVVTGRVERGIVKVGEEV
EIVGIKATTKTTVTGVEMFRKLLDQGQAGDNIGALIRGVGREDVERGQVLCKPGSVKPHT
KFKAEAYILTKDEGGRHTPFFTNYRPQFYFRTTDVTGVVTLPAGTEMVMPGDNVAMDVTL
IVPIAMEEKLRFAIREGGRTVGAGIVSSIIE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagagtaagtttgaacgtacgaagccccatgttaacatcggcacgattggtcac
gttgaccatggcaagacgtcgctgacggcggcgatcacgaagtttttcggcgaattcaag
gcgtatgaccagatcgacgctgcgcctgaagaacgcgcccgcggcatcacgatctcgacg
gcacacgtcgagtacgaaaccgcaaaccgtcactatgcgcacgtcgattgccccggccac
gccgactatgtgaagaacatgatcaccggcgctgcccagatggatggcgcgatcctggtg
gtttcggctgctgacggcccgatgccgcagacccgcgagcacattctgcttgcccgtcag
gttggcgttccggcgattgtcgtgttcctcaacaagtgcgaccaggttgacgatgcagaa
ctgctcgaactggttgaactggaagtgcgcgaacttctgtcgaagtacgaattccccggc
gacgaaatcccgatcatcaagggctcggctcttgctgctctggaagattcttccaaggaa
ctgggcgaagatgccatccgcaacctgatggacgcggttgacagctacattccgaccccg
gaacgcccgatcgaccagccgttcctgatgccgatcgaagacgtgttctcgatctccggc
cgtggtacggttgtgacgggtcgcgttgagcgcggtatcgttaaggtcggtgaagaagtt
gaaatcgtcggcatcaaggcgacgacgaagaccacggttaccggcgttgaaatgttccgc
aagctgctcgaccagggccaggctggcgacaacattggcgcgctgatccgcggcgttggc
cgtgaagacgttgaacgcggccaggttctctgcaagccgggttctgtgaagccgcacacc
aagtttaaggcagaagcctatattctgaccaaggatgaaggtggccgtcatacgccgttc
ttcaccaactaccgtccgcagttctacttccgtacgacggacgtgacgggtgttgtgacg
cttccggctggcacggaaatggtcatgcctggcgataacgtcgccatggacgttaccctg
atcgtgccgatcgccatggaagagaagcttcgcttcgctatccgtgaaggcggccgcacc
gtcggtgccggcatcgtctcgtcgatcatcgagtaa

DBGET integrated database retrieval system