KEGG   Brucella melitensis M28: BM28_B0645Help
Entry
BM28_B0645        CDS       T01852                                 

Definition
(GenBank) transport system permease
  KO
K02015  iron complex transport system permease protein
Organism
bmz  Brucella melitensis M28
Brite
KEGG Orthology (KO) [BR:bmz00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bmz02000]
    BM28_B0645
Transporters [BR:bmz02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter
    BM28_B0645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FecCD PNTB_4TM
Motif
Other DBs
NCBI-ProteinID: ADZ67894
LinkDB All DBs
Position
2:634768..635721
Genome map
AA seq 317 aa AA seqDB search
MHKRPAIVIALLGALTLLACVAFMTLGAKGSWSFVLSFRGTKLAAMVLVAYSVAVSTVLF
QTVTNNRILTPSIMGFDALYILIQTLVVFFFGAVQIDWLGPNARFLAETAIMVVFAGTLY
YWLFSGAARSLHLIMLVGIVCGVFFRSISNLMQRMLDPNLFAILQDRFFASFNAINADIL
VISAIVVAAVSLYGLRYLYVLDVLSLGRDPAINLGVDHARVVRKILFIVTVLVSVSTALV
GPITFFGLLVANLAYMISGSARHRIVLPVAVLLAVLCIVGGQTLLERVLAFNTALSVIIE
FLGGLFFIILLVRGNAR
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
ttgcataaacgccctgccatcgtcatcgcacttctgggcgcgctcacgcttcttgcctgc
gtggccttcatgacgcttggcgcaaagggaagctggtccttcgtgctttcatttcgcggc
accaagctggcagccatggttctggtcgcctattcggtggccgtctcgacggtcctgttc
cagaccgtcaccaataatcgcatcctcacgccatcgatcatgggcttcgatgcgctctat
atcctgatccagacgctcgttgtcttcttcttcggcgcagtgcagatcgactggctcggg
cccaatgcgcgctttctggctgaaaccgccatcatggtcgtgttcgcaggcacgctttat
tactggctgttttcgggcgctgcccgcagcctgcacctcatcatgctggtcggcatcgtc
tgcggcgtctttttccgcagcatttccaacctgatgcagcgaatgctcgacccaaacctg
tttgccatcctgcaagacaggttcttcgccagtttcaatgccatcaatgccgatatcctt
gtgatctcggccatcgtcgttgccgccgtatcgctctatggcctgcgttacctatatgtc
ctggacgtcctgtcgcttgggcgcgatcccgcgatcaatcttggtgtcgatcatgccagg
gtggtgcgcaagatcctgttcatagtgacggtgctcgtttccgtctccaccgccctcgtc
ggcccgatcaccttctttggccttctggtcgccaatcttgcctatatgatttcaggctcc
gcccggcaccgcatcgtgctgccagtggcggtgctattggcggttctctgcattgtcggc
ggccagaccttgcttgagcgcgtccttgcgttcaacactgcgctcagcgtcatcatcgag
tttctgggcggcctcttctttatcatccttctcgtcagggggaacgcgcgttga

DBGET integrated database retrieval system