KEGG   Brassica napus (rape): 106346700Help
Entry
106346700         CDS       T04128                                 

Definition
(RefSeq) alanine aminotransferase 1, mitochondrial
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
bna  Brassica napus (rape)
Pathway
bna00220  Arginine biosynthesis
bna00250  Alanine, aspartate and glutamate metabolism
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01200  Carbon metabolism
bna01210  2-Oxocarboxylic acid metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:bna00001]
 Metabolism
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106346700
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    106346700
   00220 Arginine biosynthesis
    106346700
Enzymes [BR:bna01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     106346700
Amino acid related enzymes [BR:bna01007]
 Aminotransferase (transaminase)
  Class I
   106346700
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_MocR
Motif
Other DBs
NCBI-GeneID: 106346700
NCBI-ProteinID: XP_013641560
UniProt: A0A078GLN0
LinkDB All DBs
AA seq 537 aa AA seqDB search
MRRFVIGQAKNLIDQTRRRPRPHNNNIRLLSLLASDPIPVSSSRFFSDMTGSDSSSSLPV
TLDSINPNVLKCEYAVRGEIVNIAQKLQDDLKINKDAYPFDEIIYCNIGNPQSLSQQPIT
FFREVLALCSHTALLDRDETHALFSADSIARAWKILDQIPGKATGAYSHSQGIKGLRDAI
AAGIEARDGLPADPNDIFMTDGASPGVHMMMQLLISSEKDGILCPIPQYPLYSASIALHG
GSLVPYYLDEASGWGLEISELKKQLEDAKSKGITVRALAVINPGNPTGQVLSEENQRDIV
DFCKKEGLVLLADEVYQENVYVPDKKFHSFKKVARSMGHGEKDISLVSFQSISKGYYGEC
GKRGGYMEVTGFTSDVREQIYKVASVNLCSNISGQILASLVMSPPKPGDESYESYIAEKE
GILSSMARRAKTLEEALNKLEGITCNRAEGAMYLFPCINLPQKAIAAAEAAKTAPDTFYC
KRLLNATGIVVVPGSGFRQVPGTWHFRCTILPQEDKIPAIVNRLTEFHKSFMDEFRD
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgcggagattcgtgattggccaagccaaaaatctcatagatcagacacgtcgtcgtcct
cgtcctcataacaacaacatccgccttctctctctccttgcttccgatcctattcctgtt
tcttcatcgcgtttcttttccgacatgactggctctgattcatcgtcctctctccccgtt
actctcgactccatcaaccccaatgttctgaaatgtgagtatgctgtccgtggagaaatt
gtcaacattgctcagaagctgcaagatgatttgaagattaacaaggatgcttatcccttt
gatgagattatctactgtaatatcggtaatcctcaatctcttagccaacagcctataaca
ttcttcagagaggttcttgctttgtgttcccacacagctttgttggaccgagatgaaaca
catgctttgttcagcgccgattctattgcgcgtgcttggaagattctcgaccagattccc
gggaaagctaccggtgcttacagccacagccagggtatcaagggactacgtgatgcaatt
gctgctggaatcgaagcacgtgatggcttacctgctgatcccaatgatattttcatgaca
gatggtgcaagccctggggttcatatgatgatgcaacttctcataagttctgagaaagat
ggaatcctttgccccattcctcagtacccattgtactcagcttcaattgcccttcacggt
ggaagtctggttccatactaccttgatgaagcatcaggatggggtcttgaaatatctgag
ctgaagaagcagctggaggatgctaagtcaaagggcatcactgtaagagccttggcggtc
attaaccctggtaacccaacaggacaggttctatcagaagaaaaccagcgtgacattgtt
gacttctgtaagaaagagggactggttcttttagctgatgaggtttatcaggaaaacgtt
tacgtccctgacaaaaagttccactctttcaagaaagtggcccggtctatgggccacggt
gagaaggatatctccttagtctcgttccaatctatctccaaaggatactacggagagtgt
ggaaagagaggaggttacatggaggttactggtttcacttctgatgtgagagagcagata
tacaaagtggcttctgtgaatctttgctccaacatctctggtcagattcttgccagtcta
gtcatgagcccacctaagcctggtgacgagtcctacgagtcatacatagcagagaaagag
ggaatcctctcgtctatggcaagacgtgcaaagactcttgaagaagctttgaacaagttg
gagggtataacatgcaatagagcagagggagctatgtatctattcccttgcattaacctt
ccacagaaggcgattgcagctgcagaagctgcaaagacggcaccggacacgttctactgc
aaacgcctcctaaacgcaactggaatagtcgtagtccctgggtctggatttagacaggta
ccgggaacatggcatttcaggtgcactatacttcctcaagaggataagattcctgcaatc
gtgaaccgtctcactgagttccacaagagcttcatggatgagttccgcgactaa

DBGET integrated database retrieval system