KEGG   Brassica napus (rape): 106347637Help
Entry
106347637         CDS       T04128                                 

Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
bna  Brassica napus (rape)
Pathway
bna00040  Pentose and glucuronate interconversions
bna00051  Fructose and mannose metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    106347637
   00051 Fructose and mannose metabolism
    106347637
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     106347637
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 PALP UDPG_MGDP_dh_N AlaDh_PNT_C Methyltransf_25 Pyr_redox_2 TrkA_N ThiF Sacchrp_dh_NADP Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 106347637
NCBI-ProteinID: XP_013642674
UniProt: A0A078J5R3
LinkDB All DBs
AA seq 414 aa AA seqDB search
MLAKKTTSLISPTLSSASFATTQTHSTLTATTLIFLIAFTLTRCFEQRRVMGKGGMSQGE
GSKVEEENMAAWLVGLNTLKIQPFPLPTLGPHDVRVRMKAVGICGSDVHYLKTMRCADFI
VKEPMVIGHECAGIIEEVGEGVKHLVVGDRVALEPGISCWRCNLCKEGRYNLCPEMKFFA
TPPVHGSLANQVVHPADLCFKLPENVSLEEGAMCEPLSVGVHACRRAEVGPETNVLVMGA
GPIGLVTMLAARAFGVPKIVIVDVDDNRLSVAKRLGADGIVKVTTSLEDVGSEVEQIKKA
IGSNIDVTFDCAGFNKTMSTALAATRCGGKVCLVGMGHGIMTVPLTPAAAREVDVVGVFR
YKNTWPLCLEFLTSGKIDVKPLITHRFGFSQKEVEDAFETSARGSNAIKVMFNL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgttggcaaagaagaccacaagtctcatttcaccgactttgtcaagcgcgagtttcgca
acaactcaaactcactccaccttgaccgcaactacacttatcttcttaatagcattcact
ctcacaaggtgctttgagcagagaagagttatgggaaaaggaggaatgtctcagggagaa
ggctcaaaggtggaagaagagaacatggctgcttggttggttggtctcaacactctcaag
atccaaccttttcctcttcctacccttggtcctcatgatgtgagagttaggatgaaggct
gttggaatttgtggaagtgatgttcattacctcaagaccatgagatgtgcggatttcatt
gtgaaagaaccgatggtgattggacatgaatgtgccgggatcattgaagaggtaggtgaa
ggagtgaaacatctagtggtcggtgaccgagtggctcttgaacctgggattagctgctgg
agatgcaacctctgcaaggaaggaagatacaatctttgtcctgagatgaagttctttgca
accccaccggttcatggctctctagctaaccaagtggttcaccctgcggatctgtgcttc
aaactgcctgagaatgtgagtctggaggaaggagcaatgtgtgagccactaagtgttggt
gtgcatgcttgtcgccgagcggaggttggtcctgagacaaacgtgttggtaatgggagcc
ggacctattggacttgtcaccatgttggctgctcgtgcttttggtgtgccaaagattgtg
attgtggatgttgatgataaccgtttatccgtagccaaacggctaggcgcagatgggatt
gttaaagtgacaacaagcttagaggatgttggttctgaggttgaacaaattaagaaagct
attgggtcaaacatcgatgtgacatttgattgtgcgggtttcaacaaaaccatgtcgaca
gcattagcagccactcgatgtggcggtaaagtctgccttgtcggaatgggtcacggtata
atgactgtccctctcactcctgcagctgcaagggaggtagatgtggtgggtgtgttcagg
tacaagaacacatggcctttatgtctcgagttccttacaagtggtaagattgatgtgaag
ccactcataacccacagatttggtttctctcagaaggaagtggaagatgcctttgaaacc
agtgctcgtggaagcaatgctattaaagttatgttcaatctctga

DBGET integrated database retrieval system