KEGG   Brassica napus (rape): 106357578Help
Entry
106357578         CDS       T04128                                 

Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00051  Fructose and mannose metabolism
bna00052  Galactose metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106357578
   00051 Fructose and mannose metabolism
    106357578
   00052 Galactose metabolism
    106357578
   00500 Starch and sucrose metabolism
    106357578
   00520 Amino sugar and nucleotide sugar metabolism
    106357578
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    106357578
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bna04131]
    106357578
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     106357578
Membrane trafficking [BR:bna04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    106357578
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 Porphobil_deamC
Motif
Other DBs
NCBI-GeneID: 106357578
NCBI-ProteinID: XP_013652713
LinkDB All DBs
AA seq 499 aa AA seqDB search
MGKVAVGATVVCAAAVCAASVYIVRRRMQSSGKWARVIEILRVLEEDCATPIGKLRQVAD
AMTVEMHAGLASEGGSKLKVLISYVDNLPSGEEHGFFYALDLGGTNFRVMRVLLGGKQGR
VVKQEAKEVSIPPHLMTSGSDELFNFIAEALANFVATEGEDFHLPEGRQRELGFTFSFPV
KQTSLSSGTLIKWTKGFSIEDTVGQDVVGALVKAMERVGLDMNVTALVNDTVGTLAGGRY
YNPDVVAAVILGTGTNAAYVERAHAIPKWHGLLPKSGEMVINMEWGNFRSSHLPLTEYDH
LLDFDSLNPGEQILEKIISGMYLGEILRRVLLKMADEAAFFGDSVPPKLRIPFIIRTPNM
SAMHSDTSPDLKVVGSKLKDILEVPTTSLKMRKVVVSLCDIIACRGARLSAAGIYGILKK
LGRDAPKDGETQKSVIAMDGGLFEHYTQFSECMESSLKELLGDEASDSVEVIHSNDGSGV
GAALLAASHSQYLDDSQTS
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaagtggctgttggtgcgacggtcgtgtgcgctgcggcggtttgcgcggcgtct
gtgtacatcgtgcggcggcggatgcaaagctccgggaaatgggcgcgtgtgatagagatc
ctgagggttctcgaggaggattgcgcgacgccaatcgggaaactgagacaagtggcggat
gcgatgacggttgagatgcacgcgggtctcgcttccgaaggtggaagcaagcttaaggtg
cttatcagctacgtcgataatcttccttctggggaagaacatggtttcttttatgcgctg
gacctaggaggaacgaacttccgtgtgatgcgtgtgcttcttggtggcaaacaaggccgt
gttgtcaaacaagaagccaaagaagtctctattcctcctcatttgatgaccagcggttcg
gatgagctgttcaattttatcgctgaagcgcttgcaaatttcgtggctacagaaggagag
gactttcatctcccagagggtagacaaagggagctaggtttcactttctcgtttccggtt
aagcagacatctttgtcttctggcactctcatcaagtggaccaaaggcttctccatcgaa
gatacagttggacaagatgtggttggtgcgcttgttaaagctatggaaagagttgggctt
gacatgaatgtcacagcccttgttaatgataccgttggaacacttgctggtggtagatac
tataaccctgatgttgtcgccgctgttattctaggcactggcacaaacgcagcttatgtt
gaacgtgcacatgccattcccaaatggcacggcttacttcccaaatctggagaaatggtg
atcaacatggagtggggaaacttcaggtcatcacatcttccattgacggagtacgaccac
ttgctggatttcgatagtctgaatcctggtgaacagattcttgagaaaatcatttctggt
atgtatttgggagagatcttgcgtagagtccttctgaaaatggctgacgaggctgctttc
tttggcgactctgtcccacctaagctgagaataccattcataataaggacaccaaacatg
tctgctatgcacagcgacacttctccggatttgaaggttgttggaagcaagttaaaggac
atattggaggtccctaccacttctctgaagatgagaaaagttgtggtcagtctgtgtgac
atcatagcttgccgcggagctcgtctatcagctgcagggatctacggaatcctcaagaaa
ctaggaagagacgcaccgaaagacggagagacgcagaaatctgtgatagccatggacggt
ggactgtttgagcactacactcagttcagcgagtgtatggagagctcgttgaaagagttg
cttggagatgaagcatcagacagcgtggaggtgattcattcgaatgatggatctggcgtt
ggagctgcattactcgctgcctcgcactctcagtacctcgatgactctcaaacaagttaa

DBGET integrated database retrieval system