KEGG   Brassica napus (rape): 106358523Help
Entry
106358523         CDS       T04128                                 

Definition
(RefSeq) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
bna  Brassica napus (rape)
Pathway
bna00052  Galactose metabolism
bna00500  Starch and sucrose metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    106358523
   00500 Starch and sucrose metabolism
    106358523
Enzymes [BR:bna01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     106358523
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 106358523
NCBI-ProteinID: XP_013653792
LinkDB All DBs
AA seq 898 aa AA seqDB search
MSETKIKMSLTQWLPTILTVVFFFWSVALPSHGSSQVGYGYVVSSVAVDSNQKVLTAKLD
LIKPSSVYAPDVQTLNLHVSLETSERLRIRVTDSTQQRWEIPETVIPRTVNHSPRRYLTE
ENNTLEDPSSDLVFTLHKTTPFGFSVSRRSSGDVLFDASPDPSDPNTYFVFKDQFLQLTS
ALPESRSNLYGLGEHTKRSFKLIPGDTLTLWNADIGSENADVNLYGSHPFYMDVRGSNGH
DEAGTSHGVLLLNSNGMDVRYDGSRITYNVIGGIIDLYVFAGPSPEMVMNQYTEFVGRPA
PMPYWSFGFHQCRYGYNNVSDLESVVDGYAKAGIPLEVMWTDIDYMDGYQDFTLDPVNFP
EDKMKSFVDTLHKNGQKYVLILDPGIGVNSSSYGTFTRGMEADVFIKRDGEPYLGDVWPG
KVYYPDFLNPAAATYWSNEIKLFLETLPLDGLWLDMNELSNFITSPPSPGSSLDDPPYQI
NNLGGRASINKKTVPATAIHFGNVSEYDAHNMYGLLEAKATHQAMEDITGKRPFLLSRST
FVSSGKYTAHWTGDNAAKWEDLAYSIPGILNFGLFGIPMVGADICGFADDTTEELCRRWI
QLGAFYPFARDHSSKGTARQELYLWDSVASSARKVLGLRMRLLPHLYTLMYEAHVSGVPI
ARPLFFSFPRDTNTYEISSQFLIGKSIMISPALEKGTVSVDAYFPAGNWFDMFNYSFAVG
GSSGKRVSLDTPADHVNVHVREGSIVAMQGEAMTTREARTKPFELLVVASKLENISGQLF
LDDGENIRMGEEGGNRDWTLVKFRCYVNGKSVVLRSEVVNPEYASRMKWSIGKVTFVGFE
NVESVKTYEVRTGERLRGPRISLLKTVVDDDDPKFMSVEVSRLSLLVGKKFEMRLKLT
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaaaccaaaatcaagatgtcacttacgcagtggctacccactatcctcaccgtt
gtcttcttcttctggagcgtagctctaccctcacatggaagttcacaagttggatacggc
tacgtcgttagctcagtggccgttgactcaaaccagaaagtcttgacggcgaagcttgat
ctgatcaaaccatcgtccgtttacgcaccagacgttcaaacgctgaaccttcatgtcagc
ttggagacaagtgagcgtttgagaatcagagtaacagactcaactcaacaaagatgggag
ataccggaaaccgttatccctcgcaccgtaaaccactctcctcgccgttacttaacggaa
gagaacaataccttggaagatccatcatcggacttagttttcacactccacaaaacgacg
ccgttcggtttctccgtctccagacgctcctccggcgacgtcctcttcgacgcgtcgccg
gatccatcggatccgaacacctacttcgtcttcaaggaccagttcctccaactaacctcc
gccttaccggaatcccgatcgaatctgtacggtctcggagaacacacgaagcgatcgttc
aagctgatcccgggagatacactgactctgtggaacgctgacatcgggagcgagaatgcg
gatgttaacctctacggatcgcatccgttctacatggatgtgagaggatctaacggtcac
gatgaagcggggacgagtcacggcgttctcttgctgaacagtaatgggatggatgtgagg
tatgatggaagtcggattacgtataatgtgatcggaggtatcatcgatctctacgtgttc
gccggaccgtcgcctgagatggtgatgaatcagtatacagagtttgttggacgacctgca
cctatgccttattggtcatttggattccatcagtgtcggtatggatacaacaatgtttca
gaccttgaatccgtggttgatggatatgcaaaagctggaatacctcttgaagttatgtgg
acagacattgattacatggatggctaccaagacttcactttggaccccgtgaacttccct
gaggacaagatgaaatcattcgtggatacacttcacaagaacggtcagaagtacgtgctg
atcttggatccaggcattggtgtgaatagctcctcttacgggacgtttactagaggaatg
gaagctgatgtgttcataaaacgagatggtgagccttatctcggcgacgtttggcctggg
aaagtatattaccctgacttcttgaatccagctgctgcaacttactggagcaacgaaatc
aagttgttcctggaaactctccctttggatggtctgtggcttgacatgaacgagttgtca
aatttcataacttcacctccatcccctggatcttcactcgatgatcctccttaccagatt
aacaacttagggggcagagcttctatcaataagaagacagtaccagcaacagctatccat
tttgggaacgttagtgaatacgatgcgcataatatgtatggactcttggaagctaaagcc
actcaccaagctatggaggatataactggaaagagaccgtttcttttgtcgagatccacg
ttcgtaagctccgggaagtacacagctcattggacaggagataacgctgcgaaatgggag
gacttggcttactcgatcccggggatactcaactttggactgtttgggatcccaatggtt
ggagctgatatctgtggtttcgcagatgataccaccgaggagctatgtcgtcgatggatt
cagcttggagcgttttacccttttgcaagagatcattcgtccaaaggtactgctagacaa
gaactatacctatgggattcggttgcttcttccgcaagaaaggttctcggccttcgtatg
agactcctcccgcatctctacacactaatgtacgaggctcacgttagcggcgtccctata
gcgcggccactcttcttctccttccctagagacaccaacacctatgagatcagttcacag
ttcttgatcggtaaaagcataatgatatctccggcgctggagaaagggacagtctccgtc
gatgcatatttccccgcagggaactggttcgacatgtttaactattcgtttgccgtcggt
ggaagttccggcaagcgtgttagtcttgatactcccgctgatcacgtcaatgttcatgtt
cgagaaggtagcattgtggctatgcaaggagaagcaatgacaactagagaagccagaacg
aaaccatttgagcttctagttgtagccagcaagcttgagaacatctcgggccaactgttt
ctagatgatggcgaaaacatacggatgggagaggaaggagggaaccgtgactggaccctg
gtgaagttccgctgctacgtaaacggaaaatccgtggtgctgagatcagaagtggtgaac
ccagagtacgcgtctaggatgaaatggagcatcgggaaagtgacgttcgtcgggtttgag
aacgtggagagcgtgaaaacgtacgaggttaggacaggggagaggttgagagggccgaga
atctctcttctcaagacggttgtggacgatgatgatcccaagtttatgagtgtggaggtt
tctagactgtcgctgcttgttgggaagaagttcgagatgcgattgaaattgacttaa

DBGET integrated database retrieval system