KEGG   Brassica napus (rape): 106365546Help
Entry
106365546         CDS       T04128                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase 6-like
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00052  Galactose metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
bna03018  RNA degradation
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106365546
   00030 Pentose phosphate pathway
    106365546
   00051 Fructose and mannose metabolism
    106365546
   00052 Galactose metabolism
    106365546
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    106365546
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bna01009]
    106365546
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bna03019]
    106365546
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     106365546
Protein phosphatases and associated proteins [BR:bna01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106365546
Messenger RNA biogenesis [BR:bna03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     106365546
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-GeneID: 106365546
NCBI-ProteinID: XP_013660458
LinkDB All DBs
AA seq 463 aa AA seqDB search
MDSNGVDEQEMKLVQGAAGYVLEDVPHLTDYILDLPTYPNPLQSNPAYSVVRQYFVDEDD
TVPQKIVVHKDSPRGTHFRRAGPRQKVYFKPADVRACIVTCGGLCPGLNTVIREIVCGLH
YMYGVTEVLGVNCGFSGFYSKNTVTLTPKDVSDIHKRGGTMLGTSRGGHDTSKIVDNIQD
REINQVYIIGGDGTQKGASAIYKEIRRRGLKVAVAGIPKTIDNDIPVIDKSFGFDTAVEE
AQRAINAAHVEATSVENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGKGG
LYEFIAKRLRENGHMVIVVAEGAGQDLVAESIEQQDASGNKLLKDVGLWMSLKIKEHFAK
QRKMDITLKYIDPTYMIRAIPANASDNVYSTLLAQSAVHGAMAGYTGFISGLVNGRHTYI
PFNRITEKQNKVVITDRMWARMLSSTNQPSFMNPPNGVTEGAN
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggattcgaacggcgtcgatgagcaggagatgaagttggtgcaaggagctgctggctac
gttctcgaagatgttcctcacttgaccgattacattctcgatctccccacttatccaaac
ccgttgcaatcaaatcccgcttattcagtagtgaggcagtattttgttgatgaggacgat
acagtcccacaaaagattgttgttcacaaggattctcctagagggacacattttagacga
gctggaccacgacaaaaggtgtatttcaagccagctgatgtacgggcatgtattgtcaca
tgtggtggtctatgccctggtcttaatacagtaatcagggagattgtctgtggtcttcac
tacatgtatggtgtcacagaagtacttggtgtgaattgtgggtttagtggtttctattcc
aaaaacactgtcactctgacaccgaaggatgttagtgacatccacaagcgcgggggaacc
atgttaggaacatctcgagggggacatgatacatcaaagatcgtcgacaacatacaggac
cgtgaaataaaccaggtttacatcattggaggtgatggaacccaaaagggagcatctgca
atatacaaggagattagacgccgtggacttaaagttgctgtcgcaggaataccaaaaacc
attgacaacgacatcccagttattgacaagtcgtttggatttgatactgcggttgaggag
gctcaacgtgccatcaatgcagcgcatgttgaagcgaccagtgtggaaaacggcattggt
cttgtcaagctaatgggtcgctacagtgggttcattgcaatgtacgcgactctggccagc
cgggacgttgactgctgtctgattccagagtcgcctttttaccttgaaggcaaaggaggg
ctttacgagttcattgcaaaacggctgagagaaaatggccacatggttatagtggttgct
gaaggtgcaggacaagatctcgtcgccgagagcattgaacagcaagatgcttcggggaac
aagctccttaaagatgttggactatggatgagtcttaaaatcaaggaacactttgcgaag
cagagaaaaatggacattactctgaaatacattgatccgacatacatgatcagagctatc
ccagccaatgcatctgacaacgtttactctactctcctcgcccaaagcgcagtccatggg
gcaatggcgggctataccggcttcatctctggccttgttaatggaaggcacacttacatt
cccttcaaccgaataacggaaaaacagaacaaagttgtgattacagacagaatgtgggct
cggatgctgtcatccacgaaccagccaagctttatgaaccctcctaatggagtcacagag
ggggcaaactga

DBGET integrated database retrieval system