KEGG   Brassica napus (rape): 106368707Help
Entry
106368707         CDS       T04128                                 

Definition
(RefSeq) uncharacterized protein LOC106368707
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
bna  Brassica napus (rape)
Pathway
bna00061  Fatty acid biosynthesis
bna00780  Biotin metabolism
bna01100  Metabolic pathways
bna01212  Fatty acid metabolism
Module
bna_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    106368707
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    106368707
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bna01004]
    106368707
Enzymes [BR:bna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     106368707
Lipid biosynthesis proteins [BR:bna01004]
 Fatty acid synthase
  Component type
   106368707
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT
Motif
Other DBs
NCBI-GeneID: 106368707
NCBI-ProteinID: XP_013664183
LinkDB All DBs
AA seq 220 aa AA seqDB search
MATASNSVLFLSSDSLSHHHNHTRTHLHLSSSRSHSVSLNRTKQQSTSLALHCSNNGDNV
SSPIELKFPTFPTVMDINQIREILPHRFPFLLVDRVIEYTPGVSAVAIKNVTINDNFFPG
HFPDRPIMPGVLMIEAMAQVGGIVMLQPEAGGSQDNNFFFAGIDKVRFRKPVIAGDTLVM
RMTLVKFQKRFGLAKMEGKAYVGGSLVCEGEFMMVSAGSS
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggctactgcatccaactcggtactcttcctgagctctgactcactgagtcatcatcac
aaccataccagaacccacctccatctctcctcctctagatcccattcagtttctctcaac
cgtaccaagcaacaatccacttccctggcgcttcattgctccaacaatggcgataacgtc
tcatccccaatcgaactcaagttcccaacgtttccaacggtcatggacattaaccagatc
agagagatactgcctcacaggttcccgtttctgctggtggatagagtgatcgagtataca
cctggcgtttcagctgtagctatcaagaacgtcactatcaatgacaacttcttccctggg
catttccctgatcgacccatcatgcctggtgttcttatgattgaggcgatggcgcaagtg
ggaggaatagtaatgctgcagccggaagcaggagggtctcaggataataacttcttcttc
gctggtattgataaagtgaggttccgcaagcccgtgattgctggagacacgttggtgatg
aggatgactcttgtcaagttccagaaacggttcgggcttgctaagatggaaggtaaagct
tatgtgggtggctctttggtctgcgagggcgagttcatgatggtttctgctggcagttct
tga

DBGET integrated database retrieval system