KEGG   Brassica napus (rape): 106368828Help
Entry
106368828         CDS       T04128                                 

Definition
(RefSeq) hexokinase-3-like
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00051  Fructose and mannose metabolism
bna00052  Galactose metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106368828
   00051 Fructose and mannose metabolism
    106368828
   00052 Galactose metabolism
    106368828
   00500 Starch and sucrose metabolism
    106368828
   00520 Amino sugar and nucleotide sugar metabolism
    106368828
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    106368828
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bna04131]
    106368828
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     106368828
Membrane trafficking [BR:bna04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    106368828
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 106368828
NCBI-ProteinID: XP_022575819
LinkDB All DBs
AA seq 843 aa AA seqDB search
MGKVAVAFAAAAVLVSCSVAAVMVGRRIKSRAKWRAVVEILKEMEEACRTPVGRLRQVVD
AMAVEMHAGLASEGGSKLKMLLTFVHHLPNGTEKGTYYALHLGGTYFRILRVHLGGERSY
LDVQDVERHPIPSHLMNSTSEVLFNFLAFSMERFIEKEGKESNSQGVKRELAFTFSFPVK
HSSISSGVLIKWTKGFEISEMVGKDVAECLQGALNRRGLDIHVAALVNDTVGALSLGYYH
DPDTVVAVVFGTGSNACYLERTDAIIKSQGLLTTSGSMVVNMEWGNFWSSHLPRTSYDID
LDAESSNPNDMGFEKIIAGLYLGDIVRRVILRMSQVSDIFGPTSPMLSEPYVLRTNSVSA
MHEDDTPELQEVARILKDLGVSEVPLKVRKLVVKICDVVTRRAGRLAAAGIAGILKKIGR
DGSGGITSGRSRSEMRMQKRTVVAVEGGLYMNYTMFREYMEEALVEILGEEVSQYVVVKA
MNSTSEVLFNFLAFSMERFIEKEGKESNSQGVKRELAFTFSFPVKHSSISSGVLIKWTKG
FEISEMVGKDVAECLQGALNRRGLDIHVAALVNDTVGALSLGYYHDPDTVVAVVFGTGSN
ACYLERTDAIIKSQGLLTTSGSMVVNMEWGNFWSSHLPRTSYDIDLDAESSNPNDMGFEK
IIAGLYLGDIVRRVILRMSQVSDIFGPTSPMLSEPYVLRTNSVSAMHEDDTPELQEVARI
LKDLGVSEVPLKVRKLVVKICDVVTRRAGRLAAAGIAGILKKIGRDGSGGITSGRSRSEM
RMQKRTVVAVEGGLYMNYTMFREYMEEALVEILGEEVSQYVVVKAMEDGSSIGSALLVAS
LQS
NT seq 2532 nt NT seq  +upstreamnt  +downstreamnt
atggggaaggttgcggttgcgtttgcggcggctgcggttttagtgtcttgctccgtggcg
gcggtgatggtggggaggaggattaagagtcgggcgaaatggagggctgtggtggagatt
ttgaaggagatggaggaagcttgtcgtactccggtggggaggttgaggcaagtggtggat
gccatggcggtggagatgcacgctggcttggcttctgaaggtggctccaagcttaaaatg
cttctcactttcgtccatcatttgcccaatgggacggagaaaggaacttattatgcactt
caccttggaggcacttactttaggattttgagggttcatctgggtggtgaaaggtcttat
ctagatgttcaagacgttgaacgacaccccataccttcacatttgatgaatagcaccagc
gaggttcttttcaactttctcgccttttccatggaaaggtttatcgaaaaagaaggaaag
gaatctaattcacaaggtgtgaaaagggaacttgcgtttacgttttcgttccctgtcaaa
cattcttctatatcttcaggagttctaatcaaatggaccaaaggttttgagattagtgaa
atggttgggaaagatgtagctgaatgtctacaaggagcgctgaacagaagaggcctagat
atccatgttgcagctcttgtgaatgatactgtcggagccctgtcacttggatattatcat
gatccagatacagttgttgcggttgtatttggaacaggtagtaatgcatgttacttggaa
cgaactgatgccataatcaagtctcagggtctgcttaccacttctggaagcatggtagtc
aatatggagtggggtaatttttggtcctcacacctcccaagaacatcgtatgacattgac
ttggatgcagagagttcaaatccaaatgatatgggatttgagaagattatagcaggattg
tatctgggtgacattgttcgaagagtaatccttcgcatgtcacaagtctccgacatcttt
ggacccacctcgcccatgttatctgagccttacgttctaagaacaaattcagtctcagcc
atgcatgaagatgacacacctgagctgcaagaagtagctaggatcttgaaagacttgggg
gtatcagaagtaccattgaaggtgagaaaactcgtggtcaagatatgcgacgtggtgaca
cgaagagcagggaggctagcagcagcgggtattgcaggaatcttgaagaagattggccga
gatggcagcggaggaatcacgagcgggagaagcagaagcgaaatgcggatgcagaaaaga
acagttgttgcggtagaaggaggattgtacatgaattacaccatgtttagagaatacatg
gaagaggctttggtggagattttaggagaagaagtgagccaatacgtggtcgttaaagcc
atgaatagcaccagcgaggttcttttcaactttctcgccttttccatggaaaggtttatc
gaaaaagaaggaaaggaatctaattcacaaggtgtgaaaagggaacttgcgtttacgttt
tcgttccctgtcaaacattcttctatatcttcaggagttctaatcaaatggaccaaaggt
tttgagattagtgaaatggttgggaaagatgtagctgaatgtctacaaggagcgctgaac
agaagaggcctagatatccatgttgcagctcttgtgaatgatactgtcggagccctgtca
cttggatattatcatgatccagatacagttgttgcggttgtatttggaacaggtagtaat
gcatgttacttggaacgaactgatgccataatcaagtctcagggtctgcttaccacttct
ggaagcatggtagtcaatatggagtggggtaatttttggtcctcacacctcccaagaaca
tcgtatgacattgacttggatgcagagagttcaaatccaaatgatatgggatttgagaag
attatagcaggattgtatctgggtgacattgttcgaagagtaatccttcgcatgtcacaa
gtctccgacatctttggacccacctcgcccatgttatctgagccttacgttctaagaaca
aattcagtctcagccatgcatgaagatgacacacctgagctgcaagaagtagctaggatc
ttgaaagacttgggggtatcagaagtaccattgaaggtgagaaaactcgtggtcaagata
tgcgacgtggtgacacgaagagcagggaggctagcagcagcgggtattgcaggaatcttg
aagaagattggccgagatggcagcggaggaatcacgagcgggagaagcagaagcgaaatg
cggatgcagaaaagaacagttgttgcggtagaaggaggattgtacatgaattacaccatg
tttagagaatacatggaagaggctttggtggagattttaggagaagaagtgagccaatac
gtggtcgttaaagccatggaagatggttccagcattggctctgctcttctcgttgcctct
ttacagtcatga

DBGET integrated database retrieval system