KEGG   Brassica napus (rape): 106373402Help
Entry
106373402         CDS       T04128                                 

Definition
(RefSeq) probable hexokinase-like 2 protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00051  Fructose and mannose metabolism
bna00052  Galactose metabolism
bna00500  Starch and sucrose metabolism
bna00520  Amino sugar and nucleotide sugar metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106373402
   00051 Fructose and mannose metabolism
    106373402
   00052 Galactose metabolism
    106373402
   00500 Starch and sucrose metabolism
    106373402
   00520 Amino sugar and nucleotide sugar metabolism
    106373402
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    106373402
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bna04131]
    106373402
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     106373402
Membrane trafficking [BR:bna04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    106373402
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 DUF1421 Miga
Motif
Other DBs
NCBI-GeneID: 106373402
NCBI-ProteinID: XP_013669033
LinkDB All DBs
AA seq 490 aa AA seqDB search
MSRKVVVVAVTAATVAAAVIIGRWMRRKERRRKQTQRILRKFARECATPVSKLWTVAEAM
VADMAASLAATPAAESRGSLNMLVSFAGSLPSGDEKGLHYGANLRGKELLLLRGTLGGNE
EPISDIHKQEISIPKDVLNGSFKELCDFISLEQVKFRGMNPGEETEDVKNLGFTLTRYVE
EIRSGSISAIHRKSLADGDDDKVLKEFVNDMNESLDRHGLKIRMNMALVDDTIGILAGGR
YYHKDTVAAVTLGMGTNAAYIEQAQEVLRWKSTIPNEQQEIVISTEWGDFRSCHLPLTEF
DAALDAESLNPGSHVFEKMVSGGYLGDIVRRVLLRMSEESALFGDILPPKLKTPYILGSP
DMAAMHQDISEDRDIVNKKLKEVFGIMDSTLAAREVVVEVCDVVAERAARVAGAGIVGMI
KKLGRLEKKMSIVIVEGGLYDHYRVFRNYLHSSVWEMLGDELSDHVVIEHSHGGSGAGAL
FFAACGNVKI
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgagtaggaaagtggtggttgtggccgtcactgctgcaacggttgcagcggctgtaata
ataggtcggtggatgcgtaggaaggagcggcggcggaaacagacgcagcgcattttgagg
aaatttgctagagaatgtgctacgccggtttcgaagctgtggacggtggcggaagccatg
gtcgccgatatggccgcctccctcgcagccacccccgccgccgagagtcgcggttccctc
aacatgctcgtttcgttcgccggttctctcccttcaggtgatgagaaggggttacattat
ggagcaaacttgcgaggcaaggaacttctattgttacgtggaactttaggaggtaacgaa
gagcctatttccgatatacataagcaggagatttcgatccctaaggatgttttaaatggt
tctttcaaggagttgtgcgatttcatatccttggagcaagttaaattccgtgggatgaat
cctggcgaagaaactgaagacgttaagaatctagggtttacgttaacacgctatgtcgag
gagattagatcaggttcaatctcggctatacatagaaagagtttagcagatggtgatgat
gacaaggttttgaaggagtttgtgaatgatatgaatgaatcattggatagacacggtctg
aaaattcggatgaacatggcgctggtggatgacacaataggaatattagctggaggaagg
tactatcacaaggatactgtggctgcggttactttaggtatgggaaccaacgctgcttac
atcgaacaagctcaagaggttttgagatggaaatcaacgataccaaacgagcaacaagag
attgttattagcaccgagtggggagatttcagatcttgtcatcttcctctaactgaattt
gatgctgctcttgatgcggaaagcttgaatccaggaagccacgtatttgagaagatggtg
tctggaggatacttaggggacatagtgagaagagttttgctaagaatgtctgaagaatct
gctctatttggagatatactgcctccaaagctcaaaactccttacattttagggtcgccg
gatatggctgccatgcatcaagatatatctgaagaccgagacatcgtaaacaaaaagctc
aaggaagttttcgggatcatggactcaactcttgcggcgagagaagtggtggttgaagtg
tgcgatgtagtagcggaaagagcggctcgtgtggcaggagcaggaatagttgggatgata
aagaagctgggaaggttggagaagaagatgagcattgtaatagttgaaggaggactttat
gatcattacagggtctttagaaactatcttcatagcagtgtttgggaaatgcttggcgac
gagttatcagatcatgtcgtcatcgaacattctcacggtggatctggtgccggagccctt
ttctttgccgcttgcggtaacgtcaaaatctag

DBGET integrated database retrieval system