KEGG   Brassica napus (rape): 106375516Help
Entry
106375516         CDS       T04128                                 

Definition
(RefSeq) histone-lysine N-methyltransferase ASHR2-like
  KO
K11426  [histone H3]-lysine4/36 N-trimethyltransferase SMYD [EC:2.1.1.354 2.1.1.357]
Organism
bna  Brassica napus (rape)
Pathway
bna00310  Lysine degradation
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    106375516
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bna03036]
    106375516
Enzymes [BR:bna01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     106375516
    2.1.1.357  [histone H3]-lysine36 N-dimethyltransferase
     106375516
Chromosome and associated proteins [BR:bna03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     106375516
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET zf-MYND
Motif
Other DBs
NCBI-GeneID: 106375516
NCBI-ProteinID: XP_013670898
LinkDB All DBs
AA seq 378 aa AA seqDB search
MNDGGAKSETLLQVTEINGRGRSLVAAQPLRAGQVVLRESPLLLYSAFPFLSSPPPPYCD
HCFRLLSQSAQRCQSCSLVSFCSPNCISSHTPWLCESLRRLHQSSSAAFADQSPERQVQA
RFLLSAYNLAAASPSDFQILLSLQGGGENGDSTSEFLHSLLSAVCPPLPVPISPELTAAL
LAKDKVNGFGLMEPFAVTNEKRSVRAYGIYPKTSFLNHDCLPNACRFDYVDSASDGNTDI
IIRMIHDVPQGREVCLSYFPVNMNYSSRQERLLDDYGFRCECDRCKVESSWSEDENEDME
EMDGEDDEEEEGVGEGCGDGVDDDSSFPHAYFFARYMCEKENCFGTLAPLPPKGHDVSRL
LECNVCGSVKEDEVVGNA
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacggcggagctaagtcggagacgctgctacaagttacagaaatcaatggaaga
ggaaggagtctagtagcggcacagcctctacgtgccggacaagttgtcctcagagagtcc
cctctcctcctctactctgctttcccatttctctcatcacctcctcctccttactgcgac
cattgtttccgactgttatctcaatcagctcagagatgtcaatcttgctctctcgtctcc
ttctgtagccctaactgcatctcctctcacactccttggctctgcgaatcccttcgccgc
cttcaccaatcgtcctccgccgcgttcgccgatcaatctccagaacgccaagtccaagct
cggttcctcctctccgcttacaacctcgccgccgcttctccttccgatttccagatcctg
ctctctctccaaggcggtggtgaaaatggagactccacttctgagttccttcactctctt
ttatccgccgtgtgtccacctcttccagttccgatctcgccggagctcacggcggctcta
ctggctaaggataaggttaacggattcggtttgatggagccgttcgctgttacgaacgag
aagcgatcggtgcgagcgtatgggatttatccgaagacgtcgtttttgaatcatgattgt
ctccctaatgcttgtagattcgattacgttgactctgcttccgatggtaatactgatatc
atcattaggatgatccatgatgttcctcaaggtagagaggtctgtttgagttacttccct
gtcaacatgaactactcgagcagacaggagaggttgcttgatgattacggttttagatgt
gagtgcgatcggtgtaaagtggaatctagttggtcggaagatgagaacgaggatatggaa
gagatggatggtgaagatgatgaggaagaagaaggagttggagaaggttgtggggacggt
gtggatgatgattctagtttcccacacgcttacttctttgcgagatatatgtgtgagaag
gagaattgttttggcactcttgctccgttaccgccaaagggtcatgatgtttcgaggctt
cttgaatgtaatgtttgtggaagtgttaaggaggatgaagttgtcggaaacgcttaa

DBGET integrated database retrieval system