KEGG   Brassica napus (rape): 106381987Help
Entry
106381987         CDS       T04128                                 

Definition
(RefSeq) S-adenosylmethionine carrier 1, chloroplastic/mitochondrial
  KO
K15111  solute carrier family 25 (mitochondrial S-adenosylmethionine transporter), member 26
Organism
bna  Brassica napus (rape)
Brite
KEGG Orthology (KO) [BR:bna00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bna02000]
    106381987
Transporters [BR:bna02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   106381987
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mito_carr Gly-zipper_YMGG
Motif
Other DBs
NCBI-GeneID: 106381987
NCBI-ProteinID: XP_013677386
LinkDB All DBs
AA seq 326 aa AA seqDB search
MAPLTLSVDVKSSSASAPDVSSRVIQIPQIKKSKGFASVSTQNENENPFDFFRTLFEGFI
AGGTAGVVVETALYPIDTIKTRLQAARGGGKIVLKGLYSGLAGNIAGVLPASALFVGVYE
PTKQKLLKTFPDHLSAVAHLTAGAIGGLAASLIRVPTEVVKQRMQTGQFASAPNAVRVIA
SQEGFKGLYAGYRSFLLRDLPFDAIQFCIYEQLCLGYKKAARRELNDPENALIGAFAGAL
TGAVTTPLDVIKTRLMVQGSAKQYQGIVDCVQTIVKEEGASALLKGIGPRVLWIGIGGSI
FFGVLESTKRTLAQRRPKTVKESKED
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggctcctcttacactctctgttgatgtgaagagctcttcagccagtgctcccgatgtc
tcgagtagggtaatacagattccacagatcaaaaagagcaaaggctttgcttcagtcagt
acacaaaacgaaaacgaaaacccttttgatttcttccgcactctctttgaggggtttata
gcaggaggtacagctggagttgtagttgaaacagctttgtaccctattgatactataaag
actagacttcaggcagctcgtggaggtggaaagattgtgctgaagggtctatattcagga
ttagctggaaatatcgctggtgtcttaccggcttcggctttgttcgttggagtttacgaa
cccacaaagcagaaactgctgaagacctttcctgatcatttaagcgcagttgctcacctg
actgcaggggccatcggtggacttgctgcctctcttattcgagtgcctacagaggttgtg
aagcagagaatgcagactggtcagtttgcttcagctcccaacgctgttcgagttattgca
tcacaagagggctttaagggtctctatgcaggataccgatctttcctattaagagacttg
ccgtttgatgctattcagttctgcatatatgagcagctctgcttggggtataaaaaagca
gcgcgtagagagcttaatgatcctgagaacgctctaattggtgcatttgctggtgctctg
acaggagcagttaccactccgcttgatgtaatcaagacaagattaatggttcagggatca
gccaaacaatatcaaggtatagttgactgtgttcaaacaattgtaaaagaggaaggagct
tctgctctcttaaagggtattgggccaagagtgttgtggataggtattggtggttcaatc
ttctttggtgtgctcgagagcacgaagagaacacttgctcaaagacgtcccaagacggtt
aaagaatccaaagaggattga

DBGET integrated database retrieval system