KEGG   Brassica napus (rape): 106390385Help
Entry
106390385         CDS       T04128                                 

Definition
(RefSeq) histone-lysine N-methyltransferase ASHH3-like isoform X1
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
bna  Brassica napus (rape)
Pathway
bna00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    106390385
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bna03036]
    106390385
Enzymes [BR:bna01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     106390385
Chromosome and associated proteins [BR:bna03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     106390385
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 106390385
NCBI-ProteinID: XP_013686291
LinkDB All DBs
AA seq 365 aa AA seqDB search
MPASKKISDRNHIGQVFNKLLKQIGEAEEEFELPDWLNKGKPTPYIFIKRNTYLTKKIKK
RVEDDGIFCSCSLSPDSSSSTVCGSNCHCGMLFSSCSSSCKCGIECNNKPFQHRYVKKLK
LIQTDKCGSGIVAEEEIQQGEFIIEYVGEVIDDKTCEERLWKMKHRGETNFYLCEINRDM
VIDATHKGNKSRYINHSCCPNTQMQKWIIDGETRIGIFATCDIKKGEHLTYDYQFVQFGA
DQDCHCGATGCRRKLGVKPKPKLPSDEALKVVVSEVAQTLPEVHQNGAIHEHDEGKPWNK
LKQEQPCPHNCIGLVLRLSRTRSDRCFCIIRNFDAVTRKHAVMFEDGATEFIDMSKEEDW
EILSD
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcctcgaagaagatttccgacaggaaccacataggacaagtgttcaacaagttg
ctgaagcagattggagaagcagaagaggagttcgagttgcctgattggttgaacaaaggg
aaaccaactccttacatcttcatcaagcgcaatacatacttgacgaagaaaatcaagaag
agggttgaggatgatggaatattctgttcttgttccttgtcccctgactcttcttcttca
accgtgtgtggtagtaactgccattgtgggatgctgttctcgagctgttcttccagttgc
aagtgtgggattgagtgtaacaataagccgttccagcaccggtatgtcaagaagttgaag
ttgattcagactgataaatgcggatcagggattgtagcagaagaagagattcaacaagga
gagtttatcattgaatacgtaggagaagttatagatgataagacttgtgaagagaggctt
tggaagatgaaacaccgtggagagacgaatttctatctgtgtgagataaacagagacatg
gtgattgatgccactcataagggaaacaagtcgagatacatcaatcatagttgctgcccc
aatacgcagatgcagaaatggatcattgatggcgagacaagaatcggcatatttgcaacc
tgtgacataaagaagggagagcatctgacttatgactatcagtttgttcagtttggtgca
gatcaagactgccattgtggagccacaggttgcagaaggaagcttggggtgaaaccaaaa
cctaaattaccctcggatgaagctcttaaagtagtggtatccgaagtagcccagacactt
cctgaggtgcatcaaaatggagctatacatgaacatgatgaaggaaagccatggaacaaa
cttaagcaagagcagccatgccctcataactgcattggtctggtgctcaggttatctcgc
accaggagtgataggtgtttttgcatcattcgaaactttgatgcggttacaagaaagcac
gcggtgatgtttgaggatggtgctactgagtttatcgacatgtccaaagaagaagattgg
gagattttatctgactaa

DBGET integrated database retrieval system