KEGG   Brassica napus (rape): 106391060Help
Entry
106391060         CDS       T04128                                 

Definition
(RefSeq) histone-lysine N-methyltransferase CLF-like isoform X1
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
bna  Brassica napus (rape)
Pathway
bna00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    106391060
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bna03036]
    106391060
Enzymes [BR:bna01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     106391060
Chromosome and associated proteins [BR:bna03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     106391060
   Polycomb group proteins
    PRC2-EZH2 complex
     106391060
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET preSET_CXC TCR
Motif
Other DBs
NCBI-GeneID: 106391060
NCBI-ProteinID: XP_013687077
LinkDB All DBs
AA seq 909 aa AA seqDB search
MASGASPSSSATRSDPHKHSTTSQAEKRAPASKEVAAVIDSLKKKLAADRCISIKKRIDE
NKKNVRGITQSTMRSCMERGGGSYKDGSDLLVKRQRDSPGMKSGLNASDADKSNNHSSFL
EDGNASSTTMVQGSSVPVKISLRPIKMPDVKRLSPYTTWVFLDRNQRMTEDQSVVGRRRI
YYDQTGGEALICSDSEEEAIDEEDEKRAFVEPEDFIIRMTLDQLGLSDSVLEELANFLSR
SSSEIKARYEVLMKEKEISESGDNQAESSLLNKDMDGALDSFDNLFCRRCLVFDCRLHGC
SQDLIFPAEKPAPWTTPVDENLTCGANCYKTLLKSNRIPANGTTEDKTGTSSDGAGTKTT
SKFSGKLNRKKTKTFPSESASSNEKCTPETSDSENGVQQDTNPEKVSSSSKVKASGRRGG
RKRNNNRVAERVSRRTQKRQKKSEASDTDSIATGSRSASDAKHKDNEDATSSSQKHVKSG
SSKNSRKNDTPVEDSKNSVKGDDPVSQLNAVASEPCSDGSLRKEEFVGENVCPGGLSEDK
SWRPLEKSLFQKGVEIFGMNSCMIARNLLCGLKSCWEVFQYMTCSENKASLFGGDALNPD
GSSKFDINGNMTNNQVRRRSRFLRRRGKVRRLKYTWKSAAYHSIRKKSTDKKDQPCRQFN
PCNCKTACGKECTCLLNGTCCEKYCGCPKSCKNRFRGCHCAKSQCRSRQCPCFAADRECD
PDVCRNCWVIGGDGTLGVPSQRGDNYECRNMKLLLKQQQRVLLGISDVSGWGAFLKNSVS
KHEYLGEYTGELISHKEADKRGKIYDRENSSFLFNLNDQFVLDAYRKGDKLKFANHSPEP
NCYAKVIMVAGDHRVGIFAKERILAGEELFYDYRYEPDRAPAWARKPEASGSKKDENVTP
SVGRPKKVA
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgggagcttcgccttcttcttccgccaccagatcggacccgcacaagcactct
acgacatctcaggcggagaagagagctccagcgtctaaggaagttgcagcagtcatagat
tcgcttaagaagaagcttgcagctgatcggtgtatctcaattaagaaaaggattgatgag
aacaagaagaatgtgcgtggcattactcaatccactatgaggtcgtgtatggaaagagga
ggcggtagctataaagacggtagtgatctcttggttaagaggcaaagagattcgcctggt
atgaaaagcggactcaatgcaagtgatgctgataagagcaacaaccatagcagcttctta
gaagatgggaatgccagttcaacaaccatggttcaagggtccagtgtccctgttaagatt
tccttgcgcccaatcaaaatgcctgatgttaaacgtttgtcgccttataccacatgggtt
tttctggataggaatcaaagaatgactgaagaccagtctgtagtgggtcgaaggagaatc
tattatgaccaaaccggcggggaagcactcatttgcagtgatagtgaagaggaggcaatt
gacgaggaagatgaaaaaagagcttttgtggagcctgaagattttattattcgcatgacc
cttgaccaactaggtctttcagactctgtcttggaggaactagcaaatttcttgtccaga
agctctagtgaaataaaggcaagatatgaagtgcttatgaaggaaaaagaaatatcagag
agtggcgataatcaagcagagagttctcttcttaacaaagatatggatggagcattggat
tctttcgacaacctgttctgccgtcgatgccttgtgtttgattgccggctgcacgggtgt
tcgcaggatcttatatttcctgctgagaaaccagctccatggactactcctgtggatgaa
aatctaacctgtggcgcaaactgctataaaacgcttctcaaatctaatagaattccagca
aatggcaccactgaagataaaactggcacttcatcagatggtgcgggtactaaaaccact
tccaagttctccggcaaacttaataggaaaaaaacaaaaaccttccctagcgaaagcgcg
tcgtctaatgaaaaatgcacgccggaaacaagcgactcagagaacggcgttcagcaggat
accaatcctgagaaagtttcatcgtcatcaaaggtgaaagctagtgggagacgtggaggt
cgtaagaggaacaacaaccgagttgctgagcgagtttctcgtaggactcaaaagaggcaa
aagaagtcagaagcttccgatactgattccatcgccaccgggagtcgttcagcaagcgat
gcaaaacataaagataatgaagatgctacatcctcttctcagaagcatgtaaaatctggg
agctctaagaattcaagaaagaatgacactcctgtagaagactccaagaattctgtgaag
ggtgacgatcctgtttcacagttaaatgctgttgcatctgaaccgtgtagcgatggaagt
ttaaggaaagaagagtttgtgggtgaaaatgtatgtccaggaggactgtctgaagataaa
tcgtggagaccacttgagaaaagccttttccaaaaaggtgttgagattttcggaatgaat
agctgcatgattgctaggaaccttctgtgtggtctgaagtcgtgttgggaggtcttccaa
tacatgacttgctcggagaacaaagcttccctctttggaggtgatgcattgaatcccgat
ggctcttccaagttcgatatcaatggaaatatgactaataaccaagtgcggagaaggtca
agatttctacgtagaagaggcaaagtgcgccggttgaagtatacttggaagtctgctgca
tatcattcaattaggaaaaagagtactgataagaaagaccagccgtgccgtcaattcaat
ccatgcaactgcaaaactgcttgcgggaaggaatgtacttgtttgctaaacggaacttgc
tgcgagaagtactgcggttgcccaaagagctgcaagaacaggtttagaggttgtcattgt
gccaaaagccagtgtcggagccgtcaatgtccgtgctttgctgcagatcgggaatgtgat
cctgatgtttgtaggaattgctgggtcattggtggggatggtacgcttggggtccctagc
caaagaggcgataattatgagtgcaggaatatgaaattactcctgaagcaacaacaaagg
gttctacttggaatatctgatgtttctggttggggagctttcttaaagaacagtgtaagt
aagcacgaatatctcggggaatacacaggagagctgatatcacataaagaagcagataaa
cgagggaagatatatgatcgcgagaattcctcttttctcttcaatctaaatgatcagttt
gtgctcgatgcttataggaaaggagacaaactgaaatttgccaatcattcccctgaacct
aattgttacgcaaaggtcattatggttgctggagatcatagagtgggtatttttgcaaag
gagaggatattggctggagaagaactgttttatgattacaggtatgagccagatcgagct
cctgcttgggccagaaaacccgaagcttcaggttctaagaaagatgaaaatgttacacct
tctgttggtagacccaagaaggttgcttag

DBGET integrated database retrieval system