KEGG   Brassica napus (rape): 106401619Help
Entry
106401619         CDS       T04128                                 

Definition
(RefSeq) DNA ligase 1-like
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
bna  Brassica napus (rape)
Pathway
bna03030  DNA replication
bna03410  Base excision repair
bna03420  Nucleotide excision repair
bna03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:bna00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    106401619
   03410 Base excision repair
    106401619
   03420 Nucleotide excision repair
    106401619
   03430 Mismatch repair
    106401619
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bna03032]
    106401619
   03400 DNA repair and recombination proteins [BR:bna03400]
    106401619
Enzymes [BR:bna01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     106401619
    6.5.1.6  DNA ligase (ATP or NAD+)
     106401619
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     106401619
DNA replication proteins [BR:bna03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    106401619
 Prokaryotic type
   Elongation factors (archaeal)
    Other elongation factors
     106401619
DNA repair and recombination proteins [BR:bna03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     106401619
   NER (nucleotide excision repair)
    Other NER factors
     106401619
   MMR (mismatch excision repair)
    Other MMR factors
     106401619
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 106401619
NCBI-ProteinID: XP_013697614
LinkDB All DBs
AA seq 799 aa AA seqDB search
MLAIRSSNHFRCISSLCTKTRFSSALVSLNRQVSPFPSSYLHRAMSSSRPSAFDALMSKA
RASAKKKTTPQASNSSPSPNKRKIAKTQDADSPKAEAFPDEPRSDSPSIAEDLKKGAKTQ
DADLTKVEAFPDSDKPRSSIAKKSRTLSQTDKVDELKSKIVLLKRKPGEFDPERVCCWEK
GERVPFLFVALAFDLISAESGRIVITDILCNMLRTVIATTPDDLVATVYLAANEIAPAHE
GVELGIGEGSIIKAISEAFGRTESQVKKLNTELGDLGLVAKGSRSSQTMMFKPEPLTVVK
VFNTFRQIAKESGKDSTEKKKDRMKALLVAATDCEPLYLTRLLQAKLRLGFSNQTVLAAL
GQAAVYNEEHSKPPPKTKSPLEEAAKIVKQVFTVLPVYDIIVPALLTGGVWNLPKTCNFT
LGVPIGPMLAKPTKGVGEILNKFQDTVFTCEYKYDGERAQVHCMEDGTFEIYSRNAERNT
GKYPDVALALSRLKKPSVKSFILDCEVVAFDREKKKILPFQILSTRARKNVNVNDIKVGV
CIFAFDMLYLNGQQLIQENLDIRREKLYGSFEEDLGYFQFATALTSSDIDEIQKFLDASV
DIGCEGLIIKTLNSDATYEPAKRSNNWLKLKKDYMDSIGDSVDLVPIAAFHGRGKRTGVF
GAFLLACYDADKEEFQSICKIGTGFSEAVLEERSTSLRSRVIPTPKQYYRVGDSLNPDVW
FEPTEVWEVKAADLTISPVHRAANGIVDPDKGISLRFPRLLRVREDKKPEEATSSEQIAD
MYQAQKHNHPSNEAKGEDD
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atgttagcgattcgatcatcgaatcacttccgatgcatttcttctctctgcactaaaacc
cgattctcctccgcattggtctctctcaatcgccaagtttctccctttccctcctcatac
ctccacagagcaatgtcttcttctcgcccctctgcatttgacgctctcatgtcgaaagct
cgcgcatccgccaagaagaaaacgacaccccaagcttccaattcatctccctccccgaac
aaaagaaaaatcgcgaaaacccaagacgccgattcgccaaaggcggaagcttttcccgat
gaacccagatcagattcgccgtcaattgcggaagatttgaagaagggagcgaaaacccaa
gacgccgatttgacaaaggtggaggcttttcctgattcggataaacccagatcgtcaatt
gcgaaaaagtctaggactttgagtcagacggataaagtcgacgaattgaagagtaagatt
gtgttgctgaagaggaagcctggcgaattcgatccggagagagtttgttgttgggagaaa
ggggagagagttccgtttctgtttgtggcattggcgtttgatttgatttcagctgagagt
gggaggattgtgattactgatattctgtgtaacatgttgaggactgttattgccaccact
cctgatgatttggtcgctactgtttatcttgcggccaacgagattgctcctgctcatgaa
ggggtggagttggggattggtgaaggttctattatcaaggccatctctgaagcttttggt
agaactgagtcccaggttaagaagctgaatacggaactaggagacttggggcttgtagca
aaaggaagccgttcgtcacagactatgatgttcaagccagaaccattgactgttgtcaag
gttttcaatacttttcgacaaattgctaaggaaagtggaaaagatagtacagaaaagaag
aaggatcggatgaaggcacttcttgtggcagcaacagactgtgaacctctgtacttaact
cgtttacttcaggcaaaattgcggttaggattctcaaatcagactgtcttagctgccttg
ggacaagcagctgtttataatgaagagcactcaaagccacccccaaaaaccaagtctcct
ttagaggaggctgcgaagattgttaaacaagtattcactgtgcttcctgtgtatgacatt
attgttcctgctcttctaactggcggtgtgtggaatcttcctaaaacttgtaacttcaca
cttggtgtacctattgggccaatgcttgcaaaaccaacaaaaggtgtaggcgagatactg
aataagttccaggacacagttttcacatgcgaatacaaatatgatggagaacgtgcacag
gtacattgtatggaggatggtacattcgagatatatagtcgaaatgctgaaaggaacact
gggaagtaccctgatgttgctcttgcgttatcaagattaaagaagccttctgtgaaatct
tttatcctggactgtgaggttgttgctttcgacagggagaaaaagaagattcttccgttt
cagattttgagcactcgagcgcgtaagaatgtgaacgtcaatgatatcaaagttggcgtg
tgcatctttgcttttgacatgttgtatctaaatggccagcaacttatccaggagaatctt
gatattcgccgagagaagctatacggatcatttgaggaagatcttggatatttccagttt
gcaactgctctaacatccagcgatatcgatgaaatacaaaagtttcttgacgcttctgtt
gacattgggtgtgaagggctaatcattaaaacattgaattcagatgcgacatatgagcct
gcaaagcgatccaataattggctaaaactgaagaaagactatatggacagcattggggac
tctgtggatcttgtaccaattgctgctttccatggacgtggcaaacgcacaggtgtcttt
ggtgcatttttactagcttgctacgatgctgataaggaagagttccagagcatttgtaaa
ataggtactggattttctgaagctgtgcttgaagaacggtctaccagtctccggtccaga
gtgattcctactcctaaacaatactaccgagttggagacagcctcaatccagatgtttgg
tttgagcccactgaggtctgggaagtgaaggcagctgacttgaccattagccctgtgcat
cgtgcagctaatggaattgtggatcctgataagggaatttctctacgttttcctcgttta
ctccgtgtacgggaagacaagaagccagaggaagcaacatcatctgaacagattgctgat
atgtaccaagctcaaaaacacaaccatccaagcaatgaagccaaaggtgaagatgattga

DBGET integrated database retrieval system