KEGG   Brassica napus (rape): 106411572Help
Entry
106411572         CDS       T04128                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn] 1
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
bna  Brassica napus (rape)
Pathway
bna04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:bna00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    106411572
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     106411572
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu SEEK1
Motif
Other DBs
NCBI-GeneID: 106411572
NCBI-ProteinID: XP_013707813
LinkDB All DBs
AA seq 152 aa AA seqDB search
MGKGVAVLNSSEGVKGTIFFTQEGDGVTSVTGTVSGLKPGLHGFHVHALGDTTNGCMSTG
PHFNPDGKQHGAPEDANRHAGDLGNIIVGDDGTATFTITDCQIPLSGPNSIVGRAVVVHA
DPDDLGKGGHELSLATGNAGGRVACGIIGLQG
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagggagtcgcagtcttgaacagcagtgagggtgttaaggggactatcttcttc
acccaggaaggagacggtgtgacctctgtgactggaacagtttctggacttaaacctggt
ctacatggtttccatgtccatgctcttggtgacaccactaacggttgcatgtccaccggt
ccacatttcaaccctgatggtaaacaacacggtgccccagaggatgctaatcgacatgct
ggtgatctaggaaacatcattgttggagatgatggaactgccaccttcacaatcactgac
tgccagatccctcttagtggaccgaactctattgtcggaagggctgttgttgtccacgca
gaccctgacgatctcggaaaggggggccatgaactcagcttggctaccggaaacgcaggc
ggccgtgttgcttgcggtattattggtcttcagggctaa

DBGET integrated database retrieval system