KEGG   Brassica napus (rape): 106416141Help
Entry
106416141         CDS       T04128                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic-like
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00020  Citrate cycle (TCA cycle)
bna00620  Pyruvate metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Module
bna_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106416141
   00020 Citrate cycle (TCA cycle)
    106416141
   00620 Pyruvate metabolism
    106416141
Enzymes [BR:bna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     106416141
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding DUF721
Motif
Other DBs
NCBI-GeneID: 106416141
NCBI-ProteinID: XP_013712429
LinkDB All DBs
AA seq 480 aa AA seqDB search
MAASSSFLSTASLSNPKSTISFASSVSPAPIPSLRRVVFRSPSSRRRVMTIRSKIREIFM
PALSSTMTEGKIVSWIKTEGEKLAKGESVVVVESDKADMDVETFYDGYLAAIVVGEGETA
PVGAAIGLLAETEAEIEEAKNKAASKPSSSAVVPSPPPATSSPAPAIAQPSPAAAASDGP
RKTVATPHAKKLAKQHKVDIGSVAGTGPFGRITASDVEAAAGLAPTVTPPPPPPPPPAAA
PAPTAKATTTSSPPLLPDASIVPFTAMQSAVSKNMIESLSVPTFRVGYPVNTDALDALYE
KVKPKGVTMTALLVKAAGMALAQHPVVNASCKDGKSFSYNSNINVAVAVAINGGLITPVL
QDADKLDLYLLSQKWKELVGKARSKQLQPHEYNSGTFTLSNLGMFGVDRFDAILPPGQGA
IMAVGASKPTLVADKDGFFSVKNKMLVNVTADHRIVYGADLAAFLQTFAKIVENPDSLTL
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggcggcttcttcttcgtttttatcaacagcttcgctatccaatcccaaatccaccatt
tcattcgcttcctccgtctcccctgctcccatcccttccctccgccgcgtcgttttccgc
tctccgtcttctcgccgccgagtaatgacgatccgatccaagattcgcgagattttcatg
ccggcgctatcctccaccatgacggaaggcaaaatcgtctcctggatcaaaaccgaaggc
gagaaactcgctaaaggagagagtgtcgtcgttgttgagtccgataaggccgatatggac
gtggaaaccttctacgacggttatctcgccgcgatcgtcgtcggagaaggagaaacagct
ccggtaggcgctgcaatcggattgctggcggagactgaggctgaaatcgaagaagctaag
aacaaagccgcctcgaaaccttcctcctccgccgttgttccatctcctcctccagctact
tcatcccccgctccggcgatcgctcagccttctccggcggcagcggcgtcagatggtccg
aggaaaaccgtagcgacgccgcatgctaagaagctcgcgaagcagcacaaagtggatatc
ggatccgttgctggaactggaccattcggtaggatcacggcttccgacgtggaggcggcg
gctggtttagctcccaccgtgacaccaccgcctcctcctcctcctcctcctgcagctgca
ccagcaccaacagctaaagctaccaccactagctcgcctcctctattgcctgacgccagc
atcgtccccttcacagcaatgcaatcagcagtatccaaaaacatgattgagagtctctcc
gttccaacgttccgtgttggttacccagtgaacactgatgcactcgacgcactctacgag
aaggtgaagccaaagggtgtgacaatgactgctttattggttaaagctgcagggatggct
cttgctcagcatcctgtggtgaacgctagctgcaaagatgggaagagttttagttacaat
agtaacattaacgttgcggttgctgttgccatcaatggcgggttgattacgcctgttcta
caagatgctgataagttggatttgtacttgttatctcaaaaatggaaagagctggtgggg
aaagctagaagcaagcaattgcaacctcatgaatacaactctggaactttcactttatct
aatctcggtatgtttggagtggatagatttgatgctattcttcctccaggacagggtgct
ataatggcggttggagcttcgaaaccaactctagttgctgataaggatgggttcttcagt
gtgaaaaacaaaatgctggtgaatgtgacagcagatcatcgtattgtctacggagctgat
ttggctgctttccttcaaacctttgcaaagatcgttgagaatccagatagcttgaccttg
tag

DBGET integrated database retrieval system