KEGG   Brassica napus (rape): 106416795Help
Entry
106416795         CDS       T04128                                 

Definition
(RefSeq) glutamate decarboxylase 4
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
bna  Brassica napus (rape)
Pathway
bna00250  Alanine, aspartate and glutamate metabolism
bna00410  beta-Alanine metabolism
bna00430  Taurine and hypotaurine metabolism
bna00650  Butanoate metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Module
bna_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    106416795
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    106416795
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    106416795
   00430 Taurine and hypotaurine metabolism
    106416795
Enzymes [BR:bna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     106416795
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 106416795
NCBI-ProteinID: XP_013713145
LinkDB All DBs
AA seq 493 aa AA seqDB search
MVLSKTASETDASIHSTFASRYVRISLPRFEMPENSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLMMESINKNYVDMDEYPVTTELQNRCVNMIARLFNAPLDDGEAAVG
VGTVGSSEAIMLAGLAFKRQWQNKRKAQGLPYDKPNIVTGANVQVCWEKFARYFEVELKE
VKLREGYYVMDPEKAVEMVDENTICVAAILGSTLTGEFEDVKLLNDLLVEKNKLTGWNTG
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVVWRTKSDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGFEGYRNVMDNCRENMMVLREGLEK
TGRFNIVSKENGVPLVAFSLKDNSRHDEFEVAETLRRFGWIVPAYTMPADAEHVTVLRVV
IREDFSRTLAERLVADFEKVLRELDTLPAKVHAKMANGKAKGVKKTEEETTREVTAYWKK
FVETKKTNKNKIC
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggttttgtctaagacagcttctgaaactgatgcttcaatccattcaacttttgcttct
cgttacgtccgcatctctctcccacgattcgagatgcctgagaactctatccctaaggaa
gcagcgtatcagatcatcaacgatgagctaatgctcgacggtaaccctaggctaaaccta
gcctctttcgtaaccacgtggatggagccagagtgtgacaaactcatgatggaatccatc
aacaagaactacgttgacatggacgagtaccctgtcaccaccgagcttcagaaccgatgc
gtcaacatgattgcgcgtctctttaacgctccgctcgatgacggcgaggcagcggttggt
gtcggcaccgtgggatcgtcggaggcgattatgttagccgggttggcttttaagagacag
tggcagaacaagcgtaaggcccaagggcttccttatgacaagcccaatatcgtaaccgga
gctaatgttcaggtttgctgggagaaattcgcaaggtatttcgaggtggagcttaaggaa
gtgaagctaagagaaggatactacgtgatggaccctgaaaaggcagtcgaaatggtagac
gagaacaccatttgtgtagcagccattctaggttcgacgctaaccggagagttcgaggac
gttaagctcctcaacgacctcctagtcgagaaaaacaagctaaccggatggaatacgggg
attcacgtggatgcagcgagtggtgggtttattgcaccgttcttgtatccggagctggag
tgggactttcggttaccattggttaagagcataaatgtgagtggtcacaaatacggtttg
gtttatgccggaatcggttgggttgtgtggagaaccaaatctgatctgccggaagaactt
atcttccacatcaattatcttggcgctgatcaacccaccttcactctcaacttctccaaa
ggttcgagtcaagtgattgctcagtactaccagctgattcgtcttggattcgagggatat
cgtaacgtgatggataattgccgcgaaaacatgatggtcctaagagaaggattagagaaa
actggacgtttcaacattgtctccaaagaaaacggtgttcctttagtggcgttttctcta
aaagacaatagccgccacgacgagttcgaagtggccgaaactctccgccgcttcgggtgg
atcgttccggcctacacgatgcccgcggatgcagaacacgtcaccgtcctccgagtggtg
attcgagaagatttctctcgaaccttagccgagagattggtcgcagactttgagaaggtt
cttcgcgagctcgatacacttccggcgaaggttcacgccaagatggctaatggaaaagct
aaaggtgttaagaagacggaggaggagacgacgagggaagttacggcatattggaagaag
tttgtggagacaaagaagactaacaagaacaagatttgctaa

DBGET integrated database retrieval system