KEGG   Brassica napus (rape): 106418428Help
Entry
106418428         CDS       T04128                                 

Definition
(RefSeq) glutathione S-transferase U19
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bna  Brassica napus (rape)
Pathway
bna00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bna00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    106418428
Enzymes [BR:bna01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     106418428
Transporters [BR:bna02000]
 Other Transporters
  Pores ion channels [TC:1]
   106418428
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_C_2 GST_N_2 GST_C GST_N_4 GST_C_3 GST_C_5 GST_C_6 Dak2
Motif
Other DBs
NCBI-GeneID: 106418428
NCBI-ProteinID: XP_013714595
UniProt: A0A078FJM2
LinkDB All DBs
AA seq 219 aa AA seqDB search
MANEVILLDFWPSMFGMRTRIALREKGIEFEYRDEDLWNKSPLLLETNPVHKKIPVLIHN
GKPVCESTIQVQYIDEVWSDKNRILPSDPYQRAQARFWVDFIDKKMYDAQRKVWGTKGEE
QETGKKEFIELLKTLESELGENTYFGGDDFGYVDIGLIGFYSWFHAYEKYGNLNIESECP
KLIAWAKTCMQRESVAKSLPDSEKVIEFVTEIRKKFMLE
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacgaagtgatccttcttgatttctggcctagcatgttcgggatgaggacgagg
atcgcgttgagggagaagggtatcgagttcgagtacagagacgaggacctgtggaacaag
agccctttgcttctcgagacaaatccggttcacaagaagattccggttctcatccacaac
ggtaaaccggtctgcgaatctacaatccaggttcagtacatagacgaggtctggtctgac
aagaaccgtatcctcccttctgatccttaccagagagctcaggctagattctgggttgat
ttcatcgacaaaaagatgtatgatgcccaaaggaaggtgtgggggaccaagggtgaggaa
caagagacaggcaagaaagagtttattgagttgctcaagacacttgaatctgagcttgga
gaaaatacttactttggtggtgatgactttggctacgtagacattggattgattgggttc
tactcgtggttccatgcatacgagaagtatggtaacttgaacatcgagtcagagtgtccg
aaactgatcgcttgggctaaaacgtgtatgcagagggagagcgtggctaagtccttgcct
gattcggagaaggttattgagttcgtcactgagatcaggaagaagtttatgcttgagtag

DBGET integrated database retrieval system