KEGG   Brassica napus (rape): 106423710Help
Entry
106423710         CDS       T04128                                 

Definition
(RefSeq) fanconi-associated nuclease 1 homolog isoform X1
  KO
K15363  fanconi-associated nuclease 1 [EC:3.1.21.- 3.1.4.1]
Organism
bna  Brassica napus (rape)
Brite
KEGG Orthology (KO) [BR:bna00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bna03400]
    106423710
Enzymes [BR:bna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.1  phosphodiesterase I
     106423710
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.-  
     106423710
DNA repair and recombination proteins [BR:bna03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     106423710
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VRR_NUC HIRAN
Motif
Other DBs
NCBI-GeneID: 106423710
NCBI-ProteinID: XP_013719935
LinkDB All DBs
AA seq 864 aa AA seqDB search
MLTGRESLLRLIGKRRRSLPSRHNLLSTPTPNSLNLDVNDSGNLISPIRDNIRSPETPTS
PGNSDDLCLSRKNKKKRRLTQTTLLQWSGSKQSEDSPFIHPQKQQQQSILEFDDDSSSEE
ISKTVALDEANGDEAIQTFIVGRKFSDIQDLEVGAKICLLRHPENIKDPNAIKVLSSDSG
LSEMLGYLPKDVSQCLSPLIDQYGLKFEGTITCVPKNSSEAVPVKVVCHKMTSDGWKESE
SAGGDFKLLWEKVLQVVEHQMQFPPKTTRYQLNFNVLVQEVLRSCSHLFTADEKTFLESF
PSLSEDSQRLFIRLYTRKGPWFRLSNISYPEVSDSLQALKDLTVSGFMSSVEDANDLSYQ
KMKEITELLNVTELRDILSVNKVFSRGSRKRDLIDSLCSYYNDRTRMDIGTMILERTGLC
AKISSTAESLIWRVERLFFLNGEQDLSSFVLLDLGIIKYPTYKCIDSDQIFSDRAKLLAY
EEAIEVAQLMDESLDSEDSGTVLKCIMIAETRISSSSSSESALFNCFTAPWVYSKMVLLG
VSFLENQKRYNQAVYLLRRLLSCFNCDGRRGYWTVRLSTDLEHMGRPNESLSVAEQGLLD
PWVRAGSRIALQRRVLRLAKPPRRWKTPTFPNLIDNKIPEVTIQGRSLNCEVGMKNRFYG
EDGEQCGVEQLALQYYNGGGGWQGMHTESSIWLTIFGLLMWDILFSDVPGVFQTRFQTAP
LDLDTESFYLTRKETIESQLEKVANGMAEEILIISYETHRGTACRGVVWERFSLEELRAA
VACVGGKCVASLCRYLAQDYRSWCSGMPDLLLWRFKENGYEGEAKLVEVKSEKDRLSEQQ
RAWLLLLMDSGFNVEICKVRPACV
NT seq 2595 nt NT seq  +upstreamnt  +downstreamnt
atgctcaccggacgagaaagcctgcttcggttgatcggaaaacgccgccgatctctcccc
agtcgccacaatctcctttcaactcctactccgaactcgttgaatctcgatgtcaacgac
tctggcaatctcatctctccaatcagagacaatatccgttctccggagactccgacttct
cccggcaattctgatgatttgtgtctatcaaggaagaacaagaagaagcggagattgact
cagaccactcttcttcagtggtcagggtccaaacaatctgaagatagtcctttcatccat
ccccagaagcagcagcagcaatcaatactcgaatttgatgatgactcaagtagtgaggag
atttcgaaaactgtggctttagacgaagccaatggtgacgaagctattcagacttttata
gttggtaggaagttcagtgatattcaggatttagaagttggggcaaagatctgtcttttg
agacaccctgagaacatcaaggatcccaacgctataaaggtactttcttctgactctggg
ttgtctgagatgcttgggtatctacccaaagatgtttcccagtgcttgtccccactgatt
gaccaatatggtcttaagtttgagggaacaataacttgtgttccgaagaattcttccgaa
gctgttccagttaaagttgtttgtcacaagatgacatctgatggttggaaagaaagtgaa
tctgctggtggagattttaagcttctgtgggagaaagttcttcaggttgttgagcatcag
atgcagtttccgcctaagacgacgagataccagttgaacttcaatgtattagtacaagag
gttctcagaagctgctctcacctattcacagccgatgaaaagacattcttggaatccttc
ccatctctttcagaggatagccagagacttttcatccgtctttacacacgaaaaggacct
tggttcaggctctcaaatatttcataccctgaggtatctgattctcttcaagctctgaag
gatctaacagttagtggattcatgagttcagtggaagacgcaaacgatctaagttaccaa
aagatgaaggagatcacagagttgcttaacgtcactgaacttcgtgatatcttatctgta
aacaaggtgttcagccgtggctcaagaaagagagaccttatagattcactttgttcttat
tacaatgatagaacaaggatggatataggaacaatgattctagaaagaacaggactgtgt
gctaagatatccagcacagcagaatctctcatatggcgtgttgagaggcttttctttctc
aacggagagcaagatctatcctcttttgttctgctagatcttggtattatcaaataccca
acctacaagtgcattgactcggaccaaatattttcagaccgggctaagcttttagcatat
gaagaggccattgaagtggctcagttgatggatgagtctcttgacagtgaggattctggg
acggtgttgaaatgcatcatgattgctgagacccgcatatctagttcctcttcttcagaa
tctgcgctatttaattgctttacagctccatgggtttactcaaagatggttctcttagga
gtttcctttcttgagaaccaaaagagatataaccaagcagtttatctactgagacgtctg
ctcagttgcttcaactgtgacgggagaagaggatactggacagtcaggttatcaacagat
ttagagcacatgggacgaccaaacgagagtctttcagtagcagaacaaggactactggat
ccttgggtgcgtgctggttcaagaatagctttgcaacgacgtgttcttcgtctagcaaaa
cctccaaggcgctggaaaactcccacctttccaaatctcatcgacaacaagatccctgag
gtcaccattcaagggaggtcattgaactgtgaagttggcatgaagaacaggttttatgga
gaagacggagagcagtgtggagttgagcagctcgcattgcagtattacaacggaggagga
ggatggcaggggatgcatacagagagtagcatctggttaaccatttttggtcttctcatg
tgggacattctgttctctgacgtccctggtgttttccaaacccggttccagactgctcca
ttggacttagatactgaatccttctatctaaccaggaaggaaacaatcgagtcacagcta
gagaaagttgcaaacggaatggctgaagagatacttatcatatcatatgaaacacaccgt
ggaacagcgtgcagaggagtggtgtgggagcggttttcgttggaggaactgagagcagca
gtggcttgtgttggaggcaagtgtgtagcatcgctttgccggtatctagctcaagactat
aggagctggtgcagtggaatgcctgatctgcttctgtggcggttcaaggagaatggttat
gaaggtgaagctaagcttgtggaagtaaagtcagagaaagataggttatcagaacagcaa
cgagcttggcttctgcttctaatggattcaggcttcaatgttgagatttgcaaagtaaga
cctgcttgtgtttaa

DBGET integrated database retrieval system