KEGG   Brassica napus (rape): 106428670Help
Entry
106428670         CDS       T04128                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit 1, mitochondrial-like
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
bna  Brassica napus (rape)
Pathway
bna00020  Citrate cycle (TCA cycle)
bna00190  Oxidative phosphorylation
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    106428670
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    106428670
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     106428670
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_10 Fer4_8 Fer2 Fer4_7 Fer4_18
Motif
Other DBs
NCBI-GeneID: 106428670
NCBI-ProteinID: XP_013724872
LinkDB All DBs
AA seq 276 aa AA seqDB search
MASGLIGRFVRTNPSRLTTAARLIPSRCTASSTDNGGGGGGKASNLKTFQIYRWNPDNPS
KPELQDYQIDLKDCGPMVLDALIKIKNEMDPSLTFRRSCREGICGSCAMNIDGCNGLACL
TKIEEGSKETTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKSPASEPGKEILQSKK
DRAKLDGMYECILCACCSTSCPSYWWNPESYLGPAALLHANRWISDSRDEYTKERLEAID
DEFKLYRCHTILNCARACPKGLNPGKQIAHIKQLQR
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atggcctccggtttaatcggaagattcgttagaaccaatccgtcgcgattaaccaccgcg
gcgaggctaatcccgtcgcgatgcacagcttcctcaacggataacggcggcggcggcggc
ggcaaagcatcgaacctgaagacgttccagatctaccgatggaaccccgacaaccccagc
aagcccgagctccaagactaccagatcgacctcaaggactgtggcccgatggtcctcgac
gccctaatcaagatcaagaacgagatggatccctccctcaccttccgccgctcgtgccga
gaagggatctgcggctcgtgcgcgatgaacatcgacgggtgcaacgggctcgcgtgcttg
acgaagatcgaggagggatccaaggagacgacgatcactcccttgccgcatatgttcgtg
atcaaggatctggtggtggacatgacgaatttttataatcagtataagagtatcgagccg
tggctgaagaggaagagtccggcgtctgagcctgggaaggagattctgcagagtaagaag
gatagggcgaagcttgatgggatgtatgagtgtattctttgtgcttgttgtagcacgtcg
tgtcctagttattggtggaaccccgagtcttatcttggccctgctgctttgctacatgcc
aacaggtggataagcgacagtcgtgatgagtacactaaggagagacttgaggctattgac
gacgagttcaagctttaccgttgccatacaatcttgaactgcgcccgtgcctgtccaaag
ggtttgaacccaggcaaacagatcgcgcatatcaagcaacttcagcgctga

DBGET integrated database retrieval system