KEGG   Brassica napus (rape): 106436221Help
Entry
106436221         CDS       T04128                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B7, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00053  Ascorbate and aldarate metabolism
bna00071  Fatty acid degradation
bna00280  Valine, leucine and isoleucine degradation
bna00310  Lysine degradation
bna00330  Arginine and proline metabolism
bna00340  Histidine metabolism
bna00380  Tryptophan metabolism
bna00410  beta-Alanine metabolism
bna00561  Glycerolipid metabolism
bna00620  Pyruvate metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106436221
   00053 Ascorbate and aldarate metabolism
    106436221
   00620 Pyruvate metabolism
    106436221
  09103 Lipid metabolism
   00071 Fatty acid degradation
    106436221
   00561 Glycerolipid metabolism
    106436221
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    106436221
   00310 Lysine degradation
    106436221
   00330 Arginine and proline metabolism
    106436221
   00340 Histidine metabolism
    106436221
   00380 Tryptophan metabolism
    106436221
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    106436221
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    106436221
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     106436221
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-GeneID: 106436221
NCBI-ProteinID: XP_013732632
LinkDB All DBs
AA seq 538 aa AA seqDB search
MASRRVSSLLSRSLFSSSSLFSLRGKDPLMSRGARRYSNLASASLEDTITPPVKVEHTQL
LINGKFVDSASGKTFPTLDPRTGEVIAQVAEGDVEDVNRAVVAARKAFDQGPWPRMTAYE
RSKILFRFADLIEKHNDEIAALETWDNGKPYEQSAKIEVPMLARVFRYYAGWADKIHGMT
VPGDGSHHVQTLHEPIGVAGQIIPWNFPLLMLSWKLGPALACGNTVVLKTAEQTPLSALL
VGRLLHEAGLPEGVVNIVSGFGPTAGAAIASHMDIDKVAFTGSTDVGKIILELASKSNLK
AVTLELGGKSPFIVCEDADVDQAVEMAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAK
ARAINRAVGDPFKSGIEQGPQVDSEQFEKILKYIRHGVDSGATLQAGGDRHGSKGYYIQP
TVFSDVKDDMLIAKDEIFGPVQTILKFKNLDEVIARANNSRYGLAAGVFTQNLDTANRLM
RALRVGSVWINCFDVFDATIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTAIKNPAWL
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcaagaagagtgtcctcgcttctatctcgctccctcttctcctcctcttctctc
ttctcccttagaggtaaagaccctctcatgagcagaggagctcgcaggtacagcaacctc
gcttctgcttctctggaggacaccatcactccaccagtgaaagtcgagcacactcagctc
ctgatcaacgggaagttcgttgattcagcctcaggaaagactttccccacattggatcca
agaactggggaagtgatagctcaggtggctgagggtgacgtggaagacgtgaaccgtgcg
gttgtagccgcgcgcaaggcctttgaccagggtccatggcctagaatgactgcttatgag
aggtcgaagatactgtttcgtttcgctgacttgattgagaaacacaacgacgagattgct
gctcttgagacttgggacaacgggaagccttatgagcagtctgccaagattgaagttcct
atgcttgctagagtgttccgttactatgctggttgggcagacaagatccatggaatgacg
gttcctggagacggttcacaccacgtgcagacgctccacgagccgataggagtcgctgga
cagatcatcccatggaacttccctcttctcatgctgtcgtggaagcttggaccagcttta
gcttgcgggaacaccgttgtgctcaagacggctgagcagactcctctctctgctcttctt
gttggaagactacttcatgaggctggacttcctgaaggagttgtgaatatagtttctgga
tttggtcctaccgctggtgcagctattgctagtcacatggacattgataaggttgctttc
accgggtctactgatgttggaaagattattcttgagttggcttcaaaaagtaacctcaag
gcagtgacccttgagcttggaggcaagtcacctttcattgtatgtgaagatgctgatgtg
gatcaggccgttgagatggctcatttcgctctcttctttaaccagggacaatgctgctgt
gctggctcgcgtacatttgtacatgaacgcgtgtatgatgagtttgtagagaaagccaaa
gctcgtgcaatcaaccgcgctgttggagatcccttcaagtcaggcattgagcaaggtccc
caggtggactcagagcagttcgagaaaatcctgaagtacattagacatggagtcgatagt
ggagccaccttacaagctggaggtgaccgtcatggctccaagggttactacattcaaccc
actgtcttctctgacgtcaaggatgacatgctcatagcaaaagacgagatcttcggacca
gttcagaccatacttaagttcaagaatctggatgaggttattgcaagggcgaacaactca
agatacggtttagctgcaggagtgttcacacagaatctggacacagcgaataggctgatg
cgagcgctgagggttggaagcgtttggataaactgtttcgatgtgtttgatgccacaatt
ccatttggagggtataagatgagtggcattggaagagagaaaggtatctacagtctcaac
aattacttgcaagtcaaggctgttgtcactgccatcaagaaccccgcttggctctaa

DBGET integrated database retrieval system