KEGG   Brassica napus (rape): 106439388Help
Entry
106439388         CDS       T04128                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase 3
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bna  Brassica napus (rape)
Pathway
bna00620  Pyruvate metabolism
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01200  Carbon metabolism
Module
bna_M00168  CAM (Crassulacean acid metabolism), dark
bna_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
bna_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
bna_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    106439388
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106439388
Enzymes [BR:bna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     106439388
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 106439388
NCBI-ProteinID: XP_013736282
LinkDB All DBs
AA seq 967 aa AA seqDB search
MAGRNIEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLRETVQEL
YELSAEYEGKREPKKLEELGKVLTSLDAGDSIVISKAFSHMLNLANLAEEVQIAYRRRIK
KLKKGDFVDESSAATESDIEETFKRLVSDLGKSPEEIFDALKNQTVDLVLTAHPTQSVRR
SLLQKHGRIRDCLAQLYAKDITPDDKQELDESLQREIQAAFRTDEIRRTPPTPQDEMRAG
MSYFHETIWNGVPKFLRRVDTALKNIGIDERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT
RDVCLLARMMAANLYYNQIENLMFELSMWRCTDEFRAKADEIHRNSRKDAAKHYIEFWKT
IPPTEPYRVILGDVRDKLYHARERSRQLLSNGISDIPEEATFTNVEQFLEPLELCYRSLC
SCGDRPIADGTLLDFLRQVSTFGLSLVRLDIRQESERHTDVLDAITKHLDGSSYRDWSEE
RRQEWLLSELSGKRPLFGPDLPKTEEIADVLDTFKVISELPSDCFGAYIISMATSPSDVL
AVELLQRECHVKTPLRVVPLFEKLADLEAAPAAVSRLFSLDWYKNRINGKQEVMIGYSDS
GKDAGRLSAAWELYKAQEELVKVAKKYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTV
NGSLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMNPPVSPKPEWRALLDAMAVVA
TEEYRSVVFQEPRFVEYFRLATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQT
RFHLPVWLGFGAAFKYAIKKDVRNLHMLQDMYKHWPFFRVTIDLIEMVFAKGDPGIAALY
DKLLVSKDLWAFGEKLRTNFEETKNLILQTAGHKDLLEGDPYLKQRLRLRDSYITTLNVC
QAYTLKRIRDQNYNVTLRPHISKEIMQSSKSAQELVKLNPTSEYAPGLEDTLILTMKGIA
AGLQNTG
NT seq 2904 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtcggaacatagagaagatggcatcaattgatgcgcagctacgacaactggct
cccgctaaagtgagtgaagacgacaagcttatcgagtacgatgctcttctcctcgaccgc
ttcctcgacattctccaggatcttcacggcgaggatctccgtgaaacggttcaagagcta
tacgagctatctgctgagtatgaaggcaagcgtgagcctaagaagcttgaggagctaggg
aaagtcctcaccagtttggacgctggtgactccattgttatctccaaggccttctcccac
atgctcaacttagcaaacttggctgaggaggttcagattgcttaccgccgtaggatcaag
aagctcaagaaaggtgatttcgttgacgagagctctgcggctactgagtctgatatcgaa
gagactttcaagaggcttgtttctgatcttggtaagtctcctgaagagatctttgatgct
ttgaagaatcagactgtggatttggttttgactgctcatcctactcagtctgtacgtaga
tctttgcttcagaagcacggcaggataagagactgtcttgcgcagctgtatgctaaagac
attactcctgatgacaagcaggagcttgatgagtctctgcaaagagagattcaagctgca
ttccgcactgatgagataaggagaacacctccaacacctcaagatgagatgagagctgga
atgagctacttccatgagacaatctggaacggtgtccctaagtttcttcgccgtgttgac
actgctctgaaaaacattgggattgatgaacgtgttccttacaatgctccattgattcag
ttctcttcttggatgggcggtgatcgtgatggtaatccgagggtcacgcctgaggtcact
agagatgtgtgcttgttggctagaatgatggctgccaatctctactataaccaaatcgag
aatctgatgtttgagttgtctatgtggcgttgcactgatgagttccgagccaaggctgat
gaaatccacaggaactcaaggaaagatgctgcaaaacattacatagaattttggaagaca
attcctccaactgagccataccgtgtgatccttggtgatgtgagggacaaactctatcac
gcacgtgagcgctctcgtcaattgctgagtaacggaatctcagacatccctgaagaagct
actttcaccaatgtggaacagttcttggagcctcttgagctatgttaccgctcactatgt
tcatgtggtgaccgcccaatagctgatggaacccttcttgatttcttgaggcaagtctcc
accttcggactctcccttgtcaggcttgacattaggcaagagtctgaacgccacaccgat
gtcttggacgctatcaccaaacacttggacggttcctcgtatagagactggtctgaagaa
cgtcgccaagaatggcttctatctgaactaagcggcaaacgtccacttttcggaccagat
cttcccaaaaccgaagaaatcgctgatgttcttgacacattcaaagtcatatccgaactg
ccttcggattgctttggagcttacattatctctatggcgacctcacctagtgatgtcctt
gctgttgagcttctacagcgtgagtgccatgtgaaaacgccgcttagagttgttcctctc
tttgagaagctagctgacctcgaagcagctcctgcagctgtttcaagactcttttcccta
gactggtacaagaaccgtatcaacggtaaacaagaggttatgattggttactctgactcg
gggaaagacgctgggcgtctctcagctgcttgggagctgtacaaagctcaagaagagctt
gtgaaggttgctaagaagtacggagtgaagctgactatgttccatggccgtggtggcact
gtcggaagaggaggtggtcccacacatcttgctatattgtctcagccaccggatacagtt
aatggctcgctgagagtgacggttcaaggtgaagtcattgagcaatcgtttggagaggaa
cacttgtgttttagaacacttcagcgtttcacagctgctactcttgagcatgggatgaac
cctcctgtttcgcccaaacctgagtggcgtgcattgctagatgcaatggcagttgttgct
actgaggaataccgatctgtggtgttccaagaacctcgatttgtcgagtacttccgcctt
gcaacacctgagctagagtatggacgtatgaacattggaagcagaccttcaaaaagaaag
ccaagcggtgggattgagtctctacgtgcaatcccatggatctttgcttggactcaaacc
agattccatcttcctgtatggctaggattcggagcagcattcaagtatgcaatcaagaag
gatgtgaggaacctccacatgctgcaagatatgtacaaacactggccgtttttccgagtc
accattgaccttattgaaatggtgttcgccaagggagaccctgggatcgctgcattgtac
gacaaacttcttgtgtcaaaagatctatgggcctttggagagaaactgagaaccaacttt
gaagaaaccaagaacctcattctccagactgctggacacaaagaccttcttgaaggagac
ccttacttgaaacagaggcttaggttgcgtgactcttacattactactctcaatgtctgt
caagcctacacattgaagagaatccgtgatcaaaactacaatgtgactctgcgaccacac
atttctaaagagatcatgcagtcgagcaaatcagcacaagagctcgtcaagcttaaccct
acgagtgagtacgcgcctggacttgaggacacgctcatcttgaccatgaagggtattgcc
gcaggattgcaaaacaccggttaa

DBGET integrated database retrieval system