KEGG   Brassica napus (rape): 106443080Help
Entry
106443080         CDS       T04128                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase FKBP53
  KO
K14826  FK506-binding nuclear protein [EC:5.2.1.8]
Organism
bna  Brassica napus (rape)
Brite
KEGG Orthology (KO) [BR:bna00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bna03009]
    106443080
Enzymes [BR:bna01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     106443080
Ribosome biogenesis [BR:bna03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    106443080
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C NPL Nucleoplasmin DUF572
Motif
Other DBs
NCBI-GeneID: 106443080
NCBI-ProteinID: XP_013740139
LinkDB All DBs
AA seq 462 aa AA seqDB search
MGFWGLEVKPGKPQAFHPKNEQGKLHLTQATLGSGSGKEKSVIQCSIAGNTPIYLCSLLP
NKTECCPLNLEFEDDDETVEFSVTGDRSIHLSGFLEEYDDGEEYEQDEDDSDGMDIAEMG
SQESSDYDSEEDEDEDEDEMDEDQMDKFEDFLDRNLEMYRQSSVPNSGVVIEEIEDEEKP
AEDTKTKRSKKKSQAAKDESANKQIVVKESAHASDLESEDEDGFPIPKAIKSGEKMSSDV
DQQGSNKKRKAKASEPDGVQESENKNKKKKNQKEKKKGESASNEKVETVSVLKKKETTQT
SSNQKAQNETKNNAMSQSSKTPDKSAEKKNKQKNTSEKATVENSKASQEQTYPNGLVVEE
LKLGKPNGKQATPGKQVSVRYIGKLQKNGKIFDSNIGKAPFKFKIGRGEVIKGWDVGVNG
MRVGEKRKLTIPPSMGYGSRGAGGQIPPNAWLSFEVELIDVK
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggggttctggggactcgaagtgaaacctggaaagcctcaagctttccatcccaaaaac
gaacaagggaagcttcacctcactcaggcaactctaggatcgggttcaggcaaagagaag
agcgtgattcagtgttccatagcaggaaacacacccatttacttgtgctcactgttgcct
aacaaaaccgagtgttgccctctgaatcttgagtttgaggacgatgacgagaccgttgag
ttctcggtgactggtgacagaagcatccacctttctggattcttggaggagtatgatgat
ggggaggagtatgagcaggacgaggatgattcagatggtatggatattgctgaaatgggg
tctcaagagtcttctgactatgatagtgaagaggatgaagatgaagatgaagatgagatg
gatgaggatcagatggataagtttgaggactttcttgatcgcaatctcgaaatgtatcgc
cagtcttctgtcccaaacagcggagttgtgattgaggagatagaagatgaagagaagcct
gccgaagatacaaagactaaacgatccaagaagaagagtcaagctgccaaagatgagagc
gcaaataaacagattgttgtcaaagagagtgcacatgcttcagatctggagagcgaagat
gaagatggctttcctattcccaaagcgattaagtctggtgagaagatgagctcagatgtt
gaccaacaaggtagcaacaaaaaacgcaaggccaaggcttctgagccagatggtgtacaa
gaaagtgaaaacaagaataaaaagaagaagaatcagaaggagaagaagaaaggcgaaagt
gcctccaatgagaaagttgagacggtcagtgtgctgaaaaagaaggaaaccacccaaact
tcttcaaaccagaaagctcaaaacgaaactaaaaacaatgccatgagtcaaagctctaag
accccagataaatctgctgagaagaaaaataagcagaagaacacaagtgagaaagctaca
gtggagaactccaaggcttctcaagaacagacatacccaaatgggctcgttgttgaggag
ttaaaattgggcaaacccaacggcaagcaagctactcctggaaagcaggtcagcgtccgt
tacatcggaaagcttcagaagaatgggaagatcttcgattccaacatcggaaaagcacct
tttaagttcaagataggtcgtggagaagtcatcaagggatgggatgtaggcgttaatgga
atgcgtgttggtgaaaaaagaaagcttacaattcctccatcaatggggtacggttctcgc
ggtgctggtggccagattcctcctaacgcttggctgtcgtttgaggtcgaactgattgat
gtcaagtaa

DBGET integrated database retrieval system