KEGG   Brassica napus (rape): 106446718Help
Entry
106446718         CDS       T04128                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn] 2, chloroplastic
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
bna  Brassica napus (rape)
Pathway
bna04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:bna00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    106446718
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     106446718
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 106446718
NCBI-ProteinID: XP_013743947
LinkDB All DBs
AA seq 207 aa AA seqDB search
MASHTFLSFSSPPRLLVSPPSTLRSPFVGVSLNLHRPQSVSFSASKKSLTVVSAAKKAVA
VLKGNSDVEGVVTLTQDDSGPTKVSVRITGLTPGPHGFHLHEFGDTTNGCISTGPHFNPN
NMTHGAPEDEIRHAGDLGNIIANADGVAETTLVDNQIPLTGPNSVVGRAFVVHELKDDLG
KGGHELSLTTGNAGGRLACGVVGLTPL
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggcttctcacaccttcctctccttctcatcgcctccgcgcctcctcgtttcccctccc
tccactctccgttcccctttcgtcggcgtctctctcaacctccaccgtccccagtccgtt
tccttctccgcctcgaagaaatcgctgacagtcgtttccgccgcgaagaaagctgtcgct
gtgctcaagggtaactccgacgtcgaaggagttgttactttgacacaagatgactcaggt
ccgacaaaagtgagtgttcgtatcaccggtctcacaccagggcctcatggctttcacctc
catgagtttggtgatacaacaaatggatgcatctcaacagggccacatttcaaccctaac
aacatgacacacggagctcctgaagacgagatccgtcatgcgggtgacctgggaaacatt
attgccaacgccgatggcgtggcagaaacaacacttgtggacaatcagattcctctgact
ggtcctaactctgttgttggaagagcctttgtggttcacgagcttaaggatgacctcgga
aagggtgggcatgagcttagcctgaccactggaaacgcaggcgggagattggcatgcggt
gtggttggtttgacgccgctctaa

DBGET integrated database retrieval system