KEGG   Brassica napus (rape): 106453031Help
Entry
106453031         CDS       T04128                                 

Definition
(RefSeq) DNA excision repair protein ERCC-1
  KO
K10849  DNA excision repair protein ERCC-1
Organism
bna  Brassica napus (rape)
Pathway
bna03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:bna00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    106453031
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bna03400]
    106453031
DNA repair and recombination proteins [BR:bna03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     106453031
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rad10 HHH_5 HHH_2 HHH HRDC PTPLA
Motif
Other DBs
NCBI-GeneID: 106453031
NCBI-ProteinID: XP_013750699
LinkDB All DBs
AA seq 396 aa AA seqDB search
MANEDDDGEKSRGTPQQIGNKPKTQIVIGVPSYQEVVESSQTKSTPPSLFKPSQTFSQAF
AFVKSSDVYSAPPPLTSSSGASHVPSTSQTPQTDVASSSTPVATGSLSSNTTQPRNAILV
SNRQKGNPLLKHIRNVKWVFSEIIPDYLLGQSTCALYLSLRYHLLHPDYLYFRIRELQKN
FKLRVVLCHVDVEDSVKPLLEVTKTALLHDCTLLCAWSLTECARYLETIKVYENKPADLI
QGQMDTDYLSRLNHSLTSIRHVNKSDVVTLGSTFGSLAHIMDASMEDLARCPGIGERKVK
RLYDTFHEPFKRAASSYPSVIEPTAPETEVQKDVNSEEPAEADEDFVEGSRKRKKMEPEK
SVKTALSTVFARYSDKLCKKKEKGTRTDSDAETHQD
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacgaagacgacgatggagagaaatcacgaggcacgccacaacagattggtaac
aaacccaaaacccagatcgtaattggtgttccttcgtaccaggaagtggtggaaagctca
cagactaagtccacgccaccatctctcttcaagccttcccagactttctctcaagcattc
gctttcgtcaaatcctccgacgtctactctgctcctcctcctctgacttcttcttccggc
gcttctcatgtgcccagtacaagccaaactcctcaaaccgatgtagcttcatcttcaact
cctgtagctactggctctctatcttcgaacactactcaaccacgtaacgcaattctcgtt
agcaatagacagaaaggaaacccgcttcttaaacatatcaggaacgtgaaatgggttttc
tcagaaatcatccctgactacttacttggtcaatccacttgcgctctgtatctaagcttg
cggtatcatctactgcacccggattatctctacttccgcataagggagctacagaagaac
ttcaaactccgtgttgttctttgccatgtcgacgttgaagattctgtgaaaccgttgctt
gaagtcaccaaaaccgctcttctccatgactgcaccctattgtgcgcctggagcttgacg
gaatgtgctcgttacttggagacgatcaaagtctatgaaaacaaacctgcggatctcatc
caaggacagatggatacagactatctctcacgtctaaaccattctcttacaagcatcaga
catgtgaacaagagcgatgtagtcacgcttggttctacatttgggtctcttgctcatata
atggatgcatccatggaagatctagctcgttgtcctggtataggcgaacgcaaggtgaag
cggttgtacgatacgttccacgaacctttcaagcgtgcagcttcgagctacccgtctgtt
atagaaccgacagctccggagactgaagttcagaaggatgtgaactcagaggaacctgct
gaggcagatgaggattttgtggagggctcgaggaaacgcaagaagatggagcctgagaaa
agtgtgaagactgcgctctcgactgttttcgctagatactctgataagctctgcaagaaa
aaggagaaaggtacaagaacagactcagatgctgaaacccaccaagattaa

DBGET integrated database retrieval system