KEGG   Brassica napus (rape): 106453988Help
Entry
106453988         CDS       T04128                                 

Definition
(RefSeq) phospho-2-dehydro-3-deoxyheptonate aldolase 1, chloroplastic
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
bna  Brassica napus (rape)
Pathway
bna00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01230  Biosynthesis of amino acids
Module
bna_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    106453988
Enzymes [BR:bna01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     106453988
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAHP_synth_2
Motif
Other DBs
NCBI-GeneID: 106453988
NCBI-ProteinID: XP_013751630
LinkDB All DBs
AA seq 400 aa AA seqDB search
MGEAFLLQGGDCAESFKEFNANNIRDTFRILLQMGAVLMFGGQVPVVKVGRMAGQFAKPR
SDSFEERNGVKLPSYRGDNINGDAFDSKSRIPDPQRMIRAYCQSAATLNLLRAFATGGYA
AMQRVTQWNLDFTEKSEQGDRYRELANRVDEALGFMHAAGLTLDHPIMQTTDFWTSHECL
LLPYEQSLTRLDSTSGLYYDCSAHMIWVGERTRQLDGAHVEFLRGVANPLGIKVSDKMDP
KELVKLIEILNADNKPGRITIITRMGAENMRVKLPHLIRAVRRAGQIVTWVSDPMHGNTI
KAPCGLKTRPFDSILAEVRAFFDVHEQEGSHPGGVHLEMTGQNVTECIGGSRTVTFDDLG
SRYHTHCDPRLNASQSLELSFIIAERLRKRRIKSQQAFSI
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaagcgtttctgttacagggaggtgattgtgcggagagcttcaaagagttcaac
gctaacaacattcgtgacacctttaggattcttctccagatgggtgctgttttgatgttc
ggtggtcaagtccctgtcgttaaggttggaagaatggcgggtcaatttgcgaagccgagg
tctgattcgtttgaggagaggaacggagtgaagctgccgagttacagaggagataacatc
aatggagatgcgtttgattccaagtctaggatccctgatccacagcggatgatcagagct
tattgtcaatctgcagctactctgaatcttttgagagcttttgctactggtggttatgct
gctatgcagagagttactcagtggaatcttgatttcactgaaaaaagtgagcaaggagac
aggtaccgtgaactagctaaccgtgttgatgaggcgcttggtttcatgcacgctgctgga
ctcaccctcgaccatcccataatgcaaacaacagacttctggacttctcatgagtgtctt
ctcttgccttatgagcaatcactaacaaggctagactctacttctggcctctactacgac
tgctctgctcatatgatctgggtcggtgagcgaaccagacagctcgatggagcccacgtc
gagttcttaagaggtgttgctaatcctcttggaatcaaggtgagtgataagatggatccg
aaggagctggtgaagctgattgagatcttgaatgctgataataagcctggaaggatcacg
attatcacaagaatgggagcagagaatatgagagtgaagcttcctcatttgatcagagcc
gtgaggcgtgctggacagattgtgacttgggtcagtgatccaatgcatggaaacaccatt
aaggctccttgtggtctcaagactcgtccctttgactccatcttggctgaagtgagggcg
tttttcgacgtgcacgagcaagaaggaagccacccgggaggtgttcacctagagatgaca
ggtcagaacgtgaccgagtgcatcggtggttcacgcacagtcacgttcgatgacttgggg
tcacgataccacacgcactgtgaccctcgcctcaacgcctcgcagtctctcgagctctct
ttcatcatcgctgaacgccttagaaagagacgcatcaagtcccaacaggctttttctatc
taa

DBGET integrated database retrieval system