KEGG   Brassica napus (rape): 111211020Help
Entry
111211020         CDS       T04128                                 

Definition
(RefSeq) glutamate decarboxylase 1-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
bna  Brassica napus (rape)
Pathway
bna00250  Alanine, aspartate and glutamate metabolism
bna00410  beta-Alanine metabolism
bna00430  Taurine and hypotaurine metabolism
bna00650  Butanoate metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    111211020
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    111211020
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    111211020
   00430 Taurine and hypotaurine metabolism
    111211020
Enzymes [BR:bna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     111211020
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 111211020
NCBI-ProteinID: XP_022567583
LinkDB All DBs
AA seq 502 aa AA seqDB search
MVLSHAASDSDVSVHSTFASRYVRTSLPRFKMPENSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLGETETAVG
VGTVGSSEAIMLAGLAFKRKWQNKRKAEGKPFDKPNIVTGANVQVCWEKFARYFEVELKE
VKLSEGYYVMDPEQAVEMVDENTICVAAILGSTLNGEFEDVKLLNDLLVLKNKETGWDTP
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVVWRNKEDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGHEGYRNVMENCRENMIVLREGLEK
TGRFNIVSKDEGVPLVAFSLKDSSSHTEFEISDMLRRYGWIVPAYTMPPNAQHITVLRVV
IREDFSRTLAERLVIDIEKVIRELDELPSRVIHKISLGEEKSEANGDNLMVTVKKTEMEK
QREIINGWKKFVSDRKKTNGIC
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggtgctctctcacgccgcatcggattcggacgtctccgtccactccacattcgcgtca
cgatacgttcgaacttcacttcctaggttcaagatgccggaaaactcgattccaaaagaa
gcggcgtatcagataataaacgatgagttgatgcttgacggtaatccaaggctaaacttg
gcctccttcgtgaccacgtggatggagcctgagtgcgacaagctcatcatggcttccatt
aacaagaactatgtcgacatggacgagtaccctgtcaccaccgaacttcagaaccgatgt
gtgaacatgattgcacatctattcaacgcacctttaggagagacagagacagccgttgga
gtagggaccgttggatcatctgaggccataatgttggccggtttggcctttaagcgtaaa
tggcagaacaagcgtaaagcggaaggcaaaccttttgataaacccaacattgtcactgga
gctaatgttcaagtgtgttgggagaaattcgctaggtactttgaggttgagcttaaggaa
gtgaaactaagcgaagggtattatgtgatggacccggagcaagctgttgagatggtcgat
gagaacactatatgtgttgcggccattcttggttccactcttaatggagaatttgaagat
gtcaaactcttgaatgatctcttggtcctaaagaacaaagaaaccggatgggacacacca
atccatgtggatgcggcaagtggaggattcatagcaccgtttttgtatccagaattggaa
tgggactttagactgcctttggtgaagagtataaatgtgagtggtcacaagtatggactt
gtgtacgcaggaattggttgggtggtttggagaaacaaagaggatttgcccgaggaactc
atcttccatatcaattatcttggtgctgaccaacccacttttacgctcaatttctccaaa
ggttcgagtcaagtcatagctcaatactaccaactcattcgattgggccacgagggttat
agaaatgtgatggagaattgcagagagaatatgatcgtgttaagggaaggacttgagaag
acaggaaggttcaacatcgtatcaaaagatgagggagtgccgcttgtcgctttctccttg
aaagacagcagctctcacactgagttcgagatctccgacatgcttcgcaggtacggatgg
atagtgccggcatatacaatgcctcctaacgcacaacacataactgttcttcgagtggtc
atcagagaagatttttcaagaacactcgcagagagacttgtgatcgatattgagaaagtg
attcgtgagctcgatgagcttccttcacgagtaatccacaaaatttcgctgggagaggag
aagagtgaagctaacggcgataacttgatggtgacggtgaaaaaaaccgagatggagaag
cagagagagatcatcaatggctggaagaagtttgtttccgacaggaaaaagacaaatggt
atctgttaa

DBGET integrated database retrieval system