KEGG   Brassica napus (rape): 111211824Help
Entry
111211824         CDS       T04128                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial-like isoform X1
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
bna  Brassica napus (rape)
Pathway
bna00020  Citrate cycle (TCA cycle)
bna00190  Oxidative phosphorylation
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    111211824
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    111211824
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     111211824
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Pyr_redox_2 FAD_binding_3 DAO GIDA HI0933_like Thi4 Lycopene_cycl Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 111211824
NCBI-ProteinID: XP_022568835
LinkDB All DBs
AA seq 226 aa AA seqDB search
MWRCVSRSLRAPSSSRTSLSGSRFSRFFSSSSQTGDYTIVDHTYDAVVVGAGGAGLRAAI
GLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGSDWLGDQDA
IQYMCREAPKAVIELENYGLPFSRTEEGKIYQRAFGGQSLDFGKGGQAYRCACAADRTGH
ALLHTLYGQAMKHNTQFFVEYFALDLLMASDGMYMGYLFLFFCSFC
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgctgcgtctctcgtagccttcgagctccttcttcatcaaggacctcactctct
ggatctcgcttttctagattcttctcctcctcttctcagacgggtgattacacgatagtg
gatcacacctatgacgcggtggttgttggagctggtggtgctggtctcagagcggccatt
ggattatctgagcatggctttaacaccgcttgcattaccaagcttttccccacacgctcc
cacaccgtcgctgctcagggtggtataaacgctgcactgggaaacatgtctgaagatgac
tggagatggcacatgtatgatactgttaaaggcagtgactggcttggtgatcaagatgct
atccagtatatgtgtagagaggcaccaaaagctgtgattgaacttgagaactacggcctt
cccttttctcgtactgaagagggtaaaatctaccagcgtgcctttggtggtcagagtctc
gactttggcaaaggtggtcaggcctatcgttgtgcttgcgctgcggatcgaactggacat
gctctcttgcataccttatatggacaagctatgaagcataacacacagttctttgttgaa
tacttcgctctggatttgctcatggctagtgatggtatgtatatgggatatcttttcctt
ttcttttgtagcttctgttag

DBGET integrated database retrieval system