KEGG   Brassica napus (rape): 111212508Help
Entry
111212508         CDS       T04128                                 

Definition
(RefSeq) glutamate decarboxylase 4 isoform X1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
bna  Brassica napus (rape)
Pathway
bna00250  Alanine, aspartate and glutamate metabolism
bna00410  beta-Alanine metabolism
bna00430  Taurine and hypotaurine metabolism
bna00650  Butanoate metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    111212508
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    111212508
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    111212508
   00430 Taurine and hypotaurine metabolism
    111212508
Enzymes [BR:bna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     111212508
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 111212508
NCBI-ProteinID: XP_022569785
LinkDB All DBs
AA seq 493 aa AA seqDB search
MVLSKTASESDVSIHSTFASRYVRTSLPRFEMPENSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLMMESINKNYVDMDEYPVTTELQNRCVNMIARLFNAPLGDGEAAVG
VGTVGSSEAIMLAGLAFKRQWQNKRKAQGLPYDKPNIVTGANVQVCWEKFARYFEVELKE
VKLREGYYVMDPEKAVEMVDENTICVAAILGSTLTGEFEDVKLLNDLLVEKNKQTGWDTG
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVVWRTKSDLPDEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGFEGYRNVMDNCRENMIVLRQGLEK
TGRFNIVSKENGVPLVAFSLKDSSCHDEFEVAETLRRFGWIVPAYTMPADAQHVTVLRVV
IREDFSRTLAERLVADFEKVLHELDTLPARVHAKMANGKANGVKKTEEETTREVTAYWKK
FVETKKSNKNRIC
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggttttgtctaagacagcttcggaatctgatgtttcaatccattcaacttttgcttct
cgttacgtccgtacctctctgccacgatttgagatgcctgagaactcgatcccaaaggaa
gcagcgtaccaaatcatcaacgacgagctaatgctcgacggtaaccctaggcttaaccta
gcctcattcgtgaccacgtggatggagccagagtgtgacaagctcatgatggaatccatc
aacaagaactacgtcgacatggacgagtaccctgtcaccaccgagcttcagaaccgatgc
gtcaacatgatcgcgcgtctcttcaacgcaccgctcggtgacggtgaggctgcggttggc
gtcggcaccgtgggatcatcggaggcgattatgttggctggtttggcctttaagagacag
tggcagaataagcggaaggctcaagggcttccttacgataagcccaatatcgtaaccgga
gctaatgttcaggtttgctgggagaagttcgcaaggtatttcgaggtggagcttaaagaa
gtgaagctaagagaaggatactacgtgatggaccctgagaaggcggtcgaaatggtagac
gagaacacaatctgtgttgcagccattctcggttcaacgttaaccggagaattcgaagac
gttaagctccttaacgacctcctagtcgagaaaaacaagcaaacgggatgggatacgggg
atccatgtggatgcagcgagtggtgggtttattgctcctttcttgtatccagagctggag
tgggatttccggttaccattggttaagagcataaatgtgagtggtcacaaatacggtttg
gtttacgctggaatcggttgggttgtatggagaaccaaatccgatttgcctgatgaactt
atcttccatatcaattatcttggcgctgaccaaccgaccttcactctcaacttctccaaa
ggttcaagtcaagtgattgctcagtactaccagctgattcgtcttggattcgagggatat
cgcaacgtgatggataattgtcgtgaaaacatgattgtcctaagacaaggattagagaag
acaggacgtttcaacatagtctccaaggaaaacggtgttccattagtggcgttctcgtta
aaagacagtagttgccacgacgagttcgaagtggctgagactctccgtcgctttgggtgg
attgttccggcctacacgatgcccgcggatgctcaacatgtcaccgtcctccgagtggtg
attcgagaagatttctctcgaaccttagccgagaggttggtcgcagacttcgagaaggtg
cttcacgagcttgatacgcttccggcaagggttcacgctaagatggccaacggaaaagct
aacggtgttaagaagactgaggaggaaaccacgagggaagttactgcgtattggaagaag
tttgtggagacaaagaagagtaacaagaacaggatttgctaa

DBGET integrated database retrieval system