KEGG   Brassica napus (rape): 11542073Help
Entry
11542073          CDS       T04128                                 

Gene name
rbcL, BRNAC_p029
Definition
(RefSeq) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
bna  Brassica napus (rape)
Pathway
bna00630  Glyoxylate and dicarboxylate metabolism
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01200  Carbon metabolism
Module
bna_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bna_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
bna_M00532  Photorespiration
bna_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    11542073 (rbcL)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    11542073 (rbcL)
Enzymes [BR:bna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     11542073 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-GeneID: 11542073
NCBI-ProteinID: YP_005089960
UniProt: Q71SX0
LinkDB All DBs
Position
CP
AA seq 479 aa AA seqDB search
MSPQTETKASVGFKAGVKEYKLNYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAE
SSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGEETQFIAYVAYPLDLFEEGSVTNMFTSI
VGNVFGFKALAALRLEDLRIPPAYTKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGL
SAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEAIYKSQAETGEIKGHYL
NATAGTCEEMMKRAIFARELGVPIVMHDYLTGGFTANTSLAHYCRDNGLLLHIHRAMHAV
IDRQKNHGMHFRVLAKALRLSGGDHVHAGTVVGKLEGDRESTLGFVDLLRDDYVEKDRSR
GIFFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAVAN
RVALEACVQARNEGRDLAVEGNEIIREACKWSPELAAACEVWKEITFNFPTIDKLDGQD
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccacaaacagagactaaagcaagtgttggattcaaagctggtgttaaagagtat
aaattgaattattatactcctgaatatgaaaccaaggatactgatatcttggcagcattc
cgagtaactcctcaacccggagttccacctgaagaagcaggggctgcggtagctgctgaa
tcttctactggtacatggacaactgtgtggaccgatgggcttaccagccttgaccgttac
aaaggacgatgctaccacatcgagcccgttccaggagaagaaactcaatttattgcgtat
gtagcttacccattagacctttttgaagaagggtctgttactaacatgtttacctcaatt
gtgggtaacgtatttgggttcaaagccctggctgctctacgtctagaggatctgcgaatc
cctccggcttatactaaaactttccagggaccacctcatggtatccaagttgaaagagat
aaattgaacaagtatggacgtcccctattaggatgtactattaaacctaagttggggtta
tccgcgaagaactatggtagagcagtttatgaatgtctacgtggtggacttgattttacc
aaagatgatgagaatgtgaactctcaaccatttatgcgttggagagaccgtttcttattt
tgtgccgaagctatttataaatcacaggctgaaacaggtgaaatcaaaggacattatttg
aatgctactgcgggtacatgcgaagaaatgatgaaaagagctatatttgccagagaattg
ggagttcctatcgtaatgcatgactacttaacagggggattcaccgcaaatactagtttg
gctcattattgccgagataatggcctacttcttcacatccaccgtgcaatgcacgctgtt
attgatagacagaagaatcatggtatgcacttccgtgtactagctaaagctttacgtcta
tcgggtggagatcatgttcacgcgggtacagtagtaggtaaacttgaaggagacagggag
tcaactttgggctttgttgatttactgcgcgatgattatgttgaaaaagaccgaagtcgt
ggtatctttttcactcaagattgggtctcactaccaggtgttctacctgtggcttcaggg
ggtattcacgtttggcatatgcctgctttgaccgagatctttggagatgattccgtacta
caatttggtggcggaactttaggccacccttggggaaatgcaccgggtgccgtagctaac
cgagtagctctagaagcatgtgtacaagctcgtaatgagggacgtgatcttgcagtcgag
ggtaatgaaattatccgtgaggcttgcaaatggagtcctgaactagctgctgcttgtgaa
gtatggaaggagatcacatttaacttcccaaccatcgataaattagatggccaagactag

DBGET integrated database retrieval system